BLASTX 7.6.2 Query= RU16312 /QuerySize=471 (470 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G60360.1 | Symbols: EDA14, UTP11 | EDA14 (EMBR... 131 3e-031 >TAIR9_protein||AT3G60360.1 | Symbols: EDA14, UTP11 | EDA14 (EMBRYO SAC DEVELOPMENT ARREST 14) | chr3:22312477-22314002 REVERSE Length = 229 Score = 131 bits (327), Expect = 3e-031 Identities = 60/85 (70%), Positives = 73/85 (85%) Frame = +3 Query: 216 MSSLRNAVSRRAHKERSQPESRKKFGFLEKHKDYVQRAKVYHKKEETLQILKQKARFRNP 395 MSSLRNA+ R AHKERSQPE+RK+FG LEKHKDY+ RA YHKK+ETL+IL+QKA F+NP Sbjct: 1 MSSLRNAIPRPAHKERSQPEARKRFGILEKHKDYIIRANAYHKKQETLKILRQKAAFKNP 60 Query: 396 DEFYFKMINTRTVDGVHKIEGQANK 470 DEF FKMIN++TVDG H+ + + NK Sbjct: 61 DEFNFKMINSKTVDGRHRPKDEVNK 85 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,965,511,112 Number of Sequences: 33410 Number of Extensions: 2965511112 Number of Successful Extensions: 156293481 Number of sequences better than 0.0: 0 |