BLASTX 7.6.2 Query= RU16494 /QuerySize=269 (268 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G41560.1 | Symbols: | FUNCTIONS IN: molecular... 96 4e-021 >TAIR9_protein||AT5G41560.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Ubiquitin ligase, Det1/DDB1-complexing (InterPro:IPR018276); Has 59 Blast hits to 59 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 46; Fungi - 0; Plants - 13; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr5:16621427-16622619 REVERSE Length = 102 Score = 96 bits (237), Expect = 4e-021 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = +2 Query: 80 MGSLFGNWPSYDPHNFSQLRPSDPTNPSKMTPTTYHATHNRTLPPPDQVITTE 238 M S+ G+ PS+DPHNFSQ RPSDP+NPSKM PTTY THNRTLPPPDQVITTE Sbjct: 1 MASILGDLPSFDPHNFSQHRPSDPSNPSKMVPTTYRPTHNRTLPPPDQVITTE 53 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,965,511,112 Number of Sequences: 33410 Number of Extensions: 2965511112 Number of Successful Extensions: 156293481 Number of sequences better than 0.0: 0 |