BLASTX 7.6.2 Query= RU16983 /QuerySize=256 (255 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G17610.1 | Symbols: | unknown protein | chr5:... 79 5e-016 >TAIR9_protein||AT5G17610.1 | Symbols: | unknown protein | chr5:5804011-5805045 FORWARD Length = 122 Score = 79 bits (193), Expect = 5e-016 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 127 KSRRPISDIETRQKKTQCYADIDSGLWGWQCKSTMIAKENCVL 255 KS RPISD+E RQKK++CY DI+SGLWGWQCKS+ IAKENC L Sbjct: 29 KSPRPISDVEIRQKKSECYGDIESGLWGWQCKSSAIAKENCAL 71 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,020,298,988 Number of Sequences: 33410 Number of Extensions: 3020298988 Number of Successful Extensions: 161251876 Number of sequences better than 0.0: 0 |