BLASTX 7.6.2 Query= RU17333 /QuerySize=257 (256 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G13230.1 | Symbols: | late embryogenesis abun... 55 6e-009 >TAIR9_protein||AT4G13230.1 | Symbols: | late embryogenesis abundant domain-containing protein / LEA domain-containing protein | chr4:7675841-7676629 REVERSE Length = 121 Score = 55 bits (132), Expect = 6e-009 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +1 Query: 1 AKQTVQDAWGSAKDTAQKAADNVMGKAQESKEFVKENAEQVKKSMNTK 144 AK T ++AW KDT +K D V GK +E+KE +K A+ V++SMNTK Sbjct: 70 AKNTAEEAWDKVKDTTEKIKDTVTGKTEETKESIKATAKTVERSMNTK 117 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,082,082,001 Number of Sequences: 33410 Number of Extensions: 3082082001 Number of Successful Extensions: 166265883 Number of sequences better than 0.0: 0 |