BLASTX 7.6.2 Query= RU17609 /QuerySize=311 (310 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G67730.1 | Symbols: YBR159, KCR1 | YBR159; ket... 70 3e-013 TAIR9_protein||AT1G24470.1 | Symbols: KCR2 | short-chain dehydro... 48 8e-007 >TAIR9_protein||AT1G67730.1 | Symbols: YBR159, KCR1 | YBR159; ketoreductase/ oxidoreductase | chr1:25391676-25393365 FORWARD Length = 319 Score = 70 bits (169), Expect = 3e-013 Identities = 28/52 (53%), Positives = 42/52 (80%) Frame = +3 Query: 153 KTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 K+QP W+L LF +GS+SI +F ++L ++ FLRP+KNL++YGSWA++TGP Sbjct: 8 KSQPTWLLILFVLGSISIFKFIFTLLRSFYIYFLRPSKNLRRYGSWAIITGP 59 >TAIR9_protein||AT1G24470.1 | Symbols: KCR2 | short-chain dehydrogenase/reductase (SDR) family protein | chr1:8674056-8676277 FORWARD Length = 313 Score = 48 bits (113), Expect = 8e-007 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 153 KTQPWWVLALFSIGSLSILR-FSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 ++QPW++ + IG L +LR + +L W FL K LK+YGSWA+VTG Sbjct: 8 ESQPWYLHFVCFIGFLFLLRVLFIPLLKWFTTRFLLTPKRLKRYGSWAMVTG 59 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,112,538,388 Number of Sequences: 33410 Number of Extensions: 3112538388 Number of Successful Extensions: 168750055 Number of sequences better than 0.0: 0 |