BLASTX 7.6.2 Query= RU17792 /QuerySize=255 (254 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G44080.1 | Symbols: | bZIP transcription fact... 104 1e-023 TAIR9_protein||AT1G03970.1 | Symbols: GBF4 | GBF4; DNA binding /... 102 5e-023 TAIR9_protein||AT2G36270.1 | Symbols: ABI5, GIA1 | ABI5 (ABA INS... 86 4e-018 TAIR9_protein||AT1G45249.1 | Symbols: ABF2, AREB1 | ABF2 (ABSCIS... 73 3e-014 TAIR9_protein||AT4G34000.1 | Symbols: ABF3, DPBF5 | ABF3 (ABSCIS... 70 2e-013 TAIR9_protein||AT4G34000.2 | Symbols: ABF3, DPBF5 | ABF3 (ABSCIS... 70 2e-013 TAIR9_protein||AT3G56850.1 | Symbols: AREB3, DPBF3 | AREB3 (ABA-... 69 4e-013 TAIR9_protein||AT3G19290.1 | Symbols: ABF4, AREB2 | ABF4 (ABRE B... 67 1e-012 TAIR9_protein||AT2G41070.1 | Symbols: EEL, ATBZIP12, DPBF4 | EEL... 67 2e-012 TAIR9_protein||AT2G41070.3 | Symbols: EEL, ATBZIP12, DPBF4 | EEL... 67 2e-012 TAIR9_protein||AT2G41070.2 | Symbols: EEL, ATBZIP12, DPBF4 | EEL... 67 2e-012 TAIR9_protein||AT3G44460.1 | Symbols: DPBF2, AtbZIP67 | DPBF2; D... 66 3e-012 TAIR9_protein||AT1G49720.1 | Symbols: ABF1 | ABF1 (ABSCISIC ACID... 65 9e-012 TAIR9_protein||AT4G34000.3 | Symbols: ABF3, DPBF5 | ABF3 (ABSCIS... 64 1e-011 TAIR9_protein||AT5G28770.1 | Symbols: BZO2H3, AtbZIP63 | BZO2H3;... 54 2e-008 TAIR9_protein||AT5G28770.2 | Symbols: BZO2H3 | BZO2H3; DNA bindi... 54 2e-008 TAIR9_protein||AT5G28770.3 | Symbols: BZO2H3 | BZO2H3; DNA bindi... 54 2e-008 TAIR9_protein||AT1G68880.1 | Symbols: AtbZIP | AtbZIP (Arabidops... 52 6e-008 TAIR9_protein||AT5G42910.1 | Symbols: | basic leucine zipper tr... 51 1e-007 TAIR9_protein||AT3G30530.1 | Symbols: ATBZIP42 | ATBZIP42 (ARABI... 48 1e-006 TAIR9_protein||AT1G45249.2 | Symbols: ABF2, AREB1 | ABF2 (ABSCIS... 46 3e-006 TAIR9_protein||AT4G02640.1 | Symbols: BZO2H1, ATBZIP10 | BZO2H1;... 46 3e-006 TAIR9_protein||AT4G02640.2 | Symbols: BZO2H1 | BZO2H1; DNA bindi... 46 3e-006 TAIR9_protein||AT1G42990.1 | Symbols: ATBZIP60, BZIP60 | ATBZIP6... 46 4e-006 TAIR9_protein||AT3G62420.1 | Symbols: ATBZIP53 | ATBZIP53 (BASIC... 46 4e-006 TAIR9_protein||AT5G15830.1 | Symbols: AtbZIP3 | AtbZIP3 (Arabido... 46 4e-006 TAIR9_protein||AT2G04038.1 | Symbols: AtbZIP48 | AtbZIP48 (Arabi... 45 6e-006 TAIR9_protein||AT5G38800.1 | Symbols: AtbZIP43 | AtbZIP43 (Arabi... 45 6e-006 TAIR9_protein||AT1G13600.1 | Symbols: AtbZIP58 | AtbZIP58 (Arabi... 45 1e-005 TAIR9_protein||AT5G24800.1 | Symbols: ATBZIP9, BZO2H2, BZIP9 | B... 45 1e-005 >TAIR9_protein||AT5G44080.1 | Symbols: | bZIP transcription factor family protein | chr5:17738787-17739734 REVERSE Length = 316 Score = 104 bits (259), Expect = 1e-023 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 1/83 (1%) Frame = -1 Query: 251 GGGGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEEN 72 GGG RG KR V PLDKA Q+QRRMIKNRESAARSRERKQAY VELE+L +LEEEN Sbjct: 212 GGGARG-KRARVMVEPLDKAAAQRQRRMIKNRESAARSRERKQAYQVELEALAAKLEEEN 270 Query: 71 ARLVREEAEQKKERYKKLMENLI 3 L +E +++KERY+KLME +I Sbjct: 271 ELLSKEIEDKRKERYQKLMEFVI 293 >TAIR9_protein||AT1G03970.1 | Symbols: GBF4 | GBF4; DNA binding / sequence-specific DNA binding / transcription factor | chr1:1018237-1019049 FORWARD Length = 271 Score = 102 bits (253), Expect = 5e-023 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 1/83 (1%) Frame = -1 Query: 251 GGGGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEEN 72 GG RG + R + EA +DKA Q+Q+RMIKNRESAARSRERKQAY VELE+L +LEEEN Sbjct: 168 GGVTRGKRGRVMMEA-MDKAAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEEN 226 Query: 71 ARLVREEAEQKKERYKKLMENLI 3 +L++E E KERYKKLME LI Sbjct: 227 EQLLKEIEESTKERYKKLMEVLI 249 >TAIR9_protein||AT2G36270.1 | Symbols: ABI5, GIA1 | ABI5 (ABA INSENSITIVE 5); DNA binding / transcription activator/ transcription factor | chr2:15204980-15206571 REVERSE Length = 443 Score = 86 bits (211), Expect = 4e-018 Identities = 46/81 (56%), Positives = 62/81 (76%), Gaps = 2/81 (2%) Frame = -1 Query: 248 GGGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENA 69 GG RG KR V + P++K +++QRRMIKNRESAARSR RKQAYTVELE+ + QL+EENA Sbjct: 338 GGLRGRKR--VVDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA 395 Query: 68 RLVREEAEQKKERYKKLMENL 6 +L AE +++R ++ E+L Sbjct: 396 QLKHALAELERKRKQQYFESL 416 >TAIR9_protein||AT1G45249.1 | Symbols: ABF2, AREB1 | ABF2 (ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING FACTOR 2); DNA binding / protein binding / transcription activator/ transcription factor | chr1:17165420-17167415 REVERSE Length = 417 Score = 73 bits (177), Expect = 3e-014 Identities = 43/83 (51%), Positives = 56/83 (67%), Gaps = 7/83 (8%) Frame = -1 Query: 248 GGGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENA 69 GG RG K V +K +++QRRMIKNRESAARSR RKQAYTVELE+ V +L+EEN Sbjct: 322 GGVRGRKSGTV-----EKVVERRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEEND 376 Query: 68 RLVREEAE--QKKERYKKLMENL 6 L R++A + ++ + M NL Sbjct: 377 ELQRKQARIMEMQKNQETEMRNL 399 >TAIR9_protein||AT4G34000.1 | Symbols: ABF3, DPBF5 | ABF3 (ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING FACTOR 3); DNA binding / protein binding / transcription activator/ transcription factor | chr4:16296008-16297971 FORWARD Length = 455 Score = 70 bits (171), Expect = 2e-013 Identities = 35/68 (51%), Positives = 52/68 (76%) Frame = -1 Query: 209 APLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEAEQKKER 30 A L+K +++Q+RMIKNRESAARSR RKQAYT+ELE+ + QL+E N L +++ E +++ Sbjct: 366 AVLEKVIERRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQVEIMEKQ 425 Query: 29 YKKLMENL 6 +L+E L Sbjct: 426 KNQLLEPL 433 >TAIR9_protein||AT4G34000.2 | Symbols: ABF3, DPBF5 | ABF3 (ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING FACTOR 3); DNA binding / protein binding / transcription activator/ transcription factor | chr4:16296008-16297971 FORWARD Length = 455 Score = 70 bits (171), Expect = 2e-013 Identities = 35/68 (51%), Positives = 52/68 (76%) Frame = -1 Query: 209 APLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEAEQKKER 30 A L+K +++Q+RMIKNRESAARSR RKQAYT+ELE+ + QL+E N L +++ E +++ Sbjct: 366 AVLEKVIERRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQVEIMEKQ 425 Query: 29 YKKLMENL 6 +L+E L Sbjct: 426 KNQLLEPL 433 >TAIR9_protein||AT3G56850.1 | Symbols: AREB3, DPBF3 | AREB3 (ABA-RESPONSIVE ELEMENT BINDING PROTEIN 3); DNA binding / transcription activator/ transcription factor | chr3:21046554-21047894 REVERSE Length = 298 Score = 69 bits (168), Expect = 4e-013 Identities = 38/66 (57%), Positives = 50/66 (75%), Gaps = 1/66 (1%) Frame = -1 Query: 236 GTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVR 57 G KR A E ++K +++Q+RMIKNRESAARSR RKQAYT ELE V++LEEEN RL + Sbjct: 211 GRKRVASGEV-VEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRK 269 Query: 56 EEAEQK 39 ++ +K Sbjct: 270 QKEVEK 275 >TAIR9_protein||AT3G19290.1 | Symbols: ABF4, AREB2 | ABF4 (ABRE BINDING FACTOR 4); DNA binding / protein binding / transcription activator/ transcription factor | chr3:6687956-6689784 FORWARD Length = 432 Score = 67 bits (163), Expect = 1e-012 Identities = 33/64 (51%), Positives = 49/64 (76%) Frame = -1 Query: 203 LDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEAEQKKERYK 24 L+K +++QRRMIKNRESAARSR RKQAYT+ELE+ + +L++ N L +++AE + + Sbjct: 347 LEKVIERRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKTNQELQKKQAEMVEMQKN 406 Query: 23 KLME 12 +L E Sbjct: 407 ELKE 410 >TAIR9_protein||AT2G41070.1 | Symbols: EEL, ATBZIP12, DPBF4 | EEL (ENHANCED EM LEVEL); DNA binding / transcription factor | chr2:17131249-17132208 FORWARD Length = 263 Score = 67 bits (161), Expect = 2e-012 Identities = 35/63 (55%), Positives = 47/63 (74%) Frame = -1 Query: 227 RRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEA 48 R+ V ++K +++Q+RMIKNRESAARSR RKQAYT ELE V++LEEEN +L R + Sbjct: 178 RKRVAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENEKLRRLKE 237 Query: 47 EQK 39 +K Sbjct: 238 VEK 240 >TAIR9_protein||AT2G41070.3 | Symbols: EEL, ATBZIP12, DPBF4 | EEL (ENHANCED EM LEVEL); DNA binding / transcription factor | chr2:17131249-17132208 FORWARD Length = 263 Score = 67 bits (161), Expect = 2e-012 Identities = 35/63 (55%), Positives = 47/63 (74%) Frame = -1 Query: 227 RRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEA 48 R+ V ++K +++Q+RMIKNRESAARSR RKQAYT ELE V++LEEEN +L R + Sbjct: 178 RKRVAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENEKLRRLKE 237 Query: 47 EQK 39 +K Sbjct: 238 VEK 240 >TAIR9_protein||AT2G41070.2 | Symbols: EEL, ATBZIP12, DPBF4 | EEL (ENHANCED EM LEVEL); DNA binding / transcription factor | chr2:17131249-17132208 FORWARD Length = 263 Score = 67 bits (161), Expect = 2e-012 Identities = 35/63 (55%), Positives = 47/63 (74%) Frame = -1 Query: 227 RRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEA 48 R+ V ++K +++Q+RMIKNRESAARSR RKQAYT ELE V++LEEEN +L R + Sbjct: 178 RKRVAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENEKLRRLKE 237 Query: 47 EQK 39 +K Sbjct: 238 VEK 240 >TAIR9_protein||AT3G44460.1 | Symbols: DPBF2, AtbZIP67 | DPBF2; DNA binding / transcription activator/ transcription activator binding / transcription factor | chr3:16080115-16081722 REVERSE Length = 332 Score = 66 bits (160), Expect = 3e-012 Identities = 33/71 (46%), Positives = 50/71 (70%) Frame = -1 Query: 227 RRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEA 48 ++ + + P + +++QRRMIKNRESAARSR R+QAYTVELE + L EEN +L Sbjct: 235 KKRIIDGPPEILMERRQRRMIKNRESAARSRARRQAYTVELELELNNLTEENTKLKEIVE 294 Query: 47 EQKKERYKKLM 15 E +K+R ++++ Sbjct: 295 ENEKKRRQEII 305 >TAIR9_protein||AT1G49720.1 | Symbols: ABF1 | ABF1 (ABSCISIC ACID RESPONSIVE ELEMENT-BINDING FACTOR 1); DNA binding / protein binding / transcription activator/ transcription factor | chr1:18400826-18402354 FORWARD Length = 393 Score = 65 bits (156), Expect = 9e-012 Identities = 36/77 (46%), Positives = 50/77 (64%), Gaps = 4/77 (5%) Frame = -1 Query: 242 GRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARL 63 GRG + L+K +++Q+RMIKNRESAARSR RKQAYT+ELE+ + L+ N L Sbjct: 298 GRGRR----SNTGLEKVVERRQKRMIKNRESAARSRARKQAYTLELEAEIESLKLVNQDL 353 Query: 62 VREEAEQKKERYKKLME 12 +++AE K +L E Sbjct: 354 QKKQAEIMKTHNSELKE 370 >TAIR9_protein||AT4G34000.3 | Symbols: ABF3, DPBF5 | ABF3 (ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING FACTOR 3); DNA binding / protein binding / transcription activator/ transcription factor | chr4:16296008-16297594 FORWARD Length = 450 Score = 64 bits (155), Expect = 1e-011 Identities = 31/53 (58%), Positives = 43/53 (81%) Frame = -1 Query: 209 APLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREE 51 A L+K +++Q+RMIKNRESAARSR RKQAYT+ELE+ + QL+E N L +++ Sbjct: 366 AVLEKVIERRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQ 418 >TAIR9_protein||AT5G28770.1 | Symbols: BZO2H3, AtbZIP63 | BZO2H3; DNA binding / protein heterodimerization/ transcription factor | chr5:10796648-10798147 REVERSE Length = 308 Score = 54 bits (127), Expect = 2e-008 Identities = 28/66 (42%), Positives = 42/66 (63%) Frame = -1 Query: 254 SGGGGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEE 75 SG G + A E ++ ++ +RM+ NRESA RSR RKQA+ ELE+ V+QL E Sbjct: 123 SGSELSGDEEEADGETNMNPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVE 182 Query: 74 NARLVR 57 N++L++ Sbjct: 183 NSKLMK 188 >TAIR9_protein||AT5G28770.2 | Symbols: BZO2H3 | BZO2H3; DNA binding / protein heterodimerization/ transcription factor | chr5:10796648-10798147 REVERSE Length = 315 Score = 54 bits (127), Expect = 2e-008 Identities = 28/66 (42%), Positives = 42/66 (63%) Frame = -1 Query: 254 SGGGGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEE 75 SG G + A E ++ ++ +RM+ NRESA RSR RKQA+ ELE+ V+QL E Sbjct: 130 SGSELSGDEEEADGETNMNPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVE 189 Query: 74 NARLVR 57 N++L++ Sbjct: 190 NSKLMK 195 >TAIR9_protein||AT5G28770.3 | Symbols: BZO2H3 | BZO2H3; DNA binding / protein heterodimerization/ transcription factor | chr5:10796907-10798147 REVERSE Length = 251 Score = 54 bits (127), Expect = 2e-008 Identities = 28/66 (42%), Positives = 42/66 (63%) Frame = -1 Query: 254 SGGGGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEE 75 SG G + A E ++ ++ +RM+ NRESA RSR RKQA+ ELE+ V+QL E Sbjct: 130 SGSELSGDEEEADGETNMNPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVE 189 Query: 74 NARLVR 57 N++L++ Sbjct: 190 NSKLMK 195 >TAIR9_protein||AT1G68880.1 | Symbols: AtbZIP | AtbZIP (Arabidopsis thaliana basic leucine-zipper 8); DNA binding / transcription factor | chr1:25894499-25894915 REVERSE Length = 139 Score = 52 bits (123), Expect = 6e-008 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = -1 Query: 188 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEAEQKKERYKKLME 12 ++K+RR + NRESA RSR RKQ + EL S++ QL +N LV +E Q +E Y+K++E Sbjct: 46 ERKRRRKVSNRESARRSRMRKQRHMEELWSMLVQLINKNKSLV-DELSQARECYEKVIE 103 >TAIR9_protein||AT5G42910.1 | Symbols: | basic leucine zipper transcription factor (BZIP15) | chr5:17203908-17205211 FORWARD Length = 371 Score = 51 bits (121), Expect = 1e-007 Identities = 31/80 (38%), Positives = 48/80 (60%), Gaps = 4/80 (5%) Frame = -1 Query: 245 GGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENAR 66 GG+ ++ +DK K RR IKNRESAARSR RKQA T+E+E + L+++ Sbjct: 279 GGKINSEITAEKQFVDK----KLRRKIKNRESAARSRARKQAQTMEVEVELENLKKDYEE 334 Query: 65 LVREEAEQKKERYKKLMENL 6 L+++ E +K + + M +L Sbjct: 335 LLKQHVELRKRQMEPGMISL 354 >TAIR9_protein||AT3G30530.1 | Symbols: ATBZIP42 | ATBZIP42 (ARABIDOPSIS THALIANA BASIC LEUCINE-ZIPPER 42); DNA binding / protein heterodimerization/ protein homodimerization/ transcription factor | chr3:12139512-12140033 FORWARD Length = 174 Score = 48 bits (112), Expect = 1e-006 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = -1 Query: 188 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEAEQKKERYKKLMEN 9 ++KQRRMI NRESA RSR RKQ + EL S V L EN +L+ + + K L EN Sbjct: 80 ERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVLQEN 139 >TAIR9_protein||AT1G45249.2 | Symbols: ABF2, AREB1 | ABF2 (ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING FACTOR 2); DNA binding / protein binding / transcription activator/ transcription factor | chr1:17166189-17167415 REVERSE Length = 409 Score = 46 bits (108), Expect = 3e-006 Identities = 28/60 (46%), Positives = 36/60 (60%), Gaps = 11/60 (18%) Frame = -1 Query: 248 GGGRGTKRRAVQEAPLDKATQQKQRRMIKNRESAARSRERKQA------YTVELESLVTQ 87 GG RG K V +K +++QRRMIKNRESAARSR RKQ Y L+ +++Q Sbjct: 322 GGVRGRKSGTV-----EKVVERRQRRMIKNRESAARSRARKQVNLFITIYLCTLDCVISQ 376 >TAIR9_protein||AT4G02640.1 | Symbols: BZO2H1, ATBZIP10 | BZO2H1; DNA binding / protein heterodimerization/ sequence-specific DNA binding / transcription factor | chr4:1154031-1156085 FORWARD Length = 412 Score = 46 bits (108), Expect = 3e-006 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = -1 Query: 185 QKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVRE 54 +K RRM+ NRESA RSR RKQ T +LE+ V L+ E++ L+++ Sbjct: 217 KKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQ 260 >TAIR9_protein||AT4G02640.2 | Symbols: BZO2H1 | BZO2H1; DNA binding / protein heterodimerization/ sequence-specific DNA binding / transcription factor | chr4:1154031-1156085 FORWARD Length = 418 Score = 46 bits (108), Expect = 3e-006 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = -1 Query: 185 QKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVRE 54 +K RRM+ NRESA RSR RKQ T +LE+ V L+ E++ L+++ Sbjct: 223 KKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQ 266 >TAIR9_protein||AT1G42990.1 | Symbols: ATBZIP60, BZIP60 | ATBZIP60 (BASIC REGION/LEUCINE ZIPPER MOTIF 60); DNA binding / transcription factor | chr1:16136062-16137459 REVERSE Length = 296 Score = 46 bits (107), Expect = 4e-006 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 200 DKATQQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVR 57 D A +K+RR ++NR++A RSRERK+ Y +LE LE E RL R Sbjct: 137 DDAVAKKRRRRVRNRDAAVRSRERKKEYVQDLEKKSKYLERECLRLGR 184 >TAIR9_protein||AT3G62420.1 | Symbols: ATBZIP53 | ATBZIP53 (BASIC REGION/LEUCINE ZIPPER MOTIF 53); DNA binding / protein heterodimerization/ sequence-specific DNA binding / transcription factor | chr3:23091844-23092284 REVERSE Length = 147 Score = 46 bits (107), Expect = 4e-006 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 4/59 (6%) Frame = -1 Query: 188 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEAEQKKERYKKLME 12 ++K++RMI NRESA RSR RKQ +L + VT L+ +NA++ EQ E KK +E Sbjct: 24 ERKRKRMISNRESARRSRMRKQKQLGDLINEVTLLKNDNAKI----TEQVDEASKKYIE 78 >TAIR9_protein||AT5G15830.1 | Symbols: AtbZIP3 | AtbZIP3 (Arabidopsis thaliana basic leucine-zipper 3); DNA binding / transcription factor | chr5:5168591-5169151 FORWARD Length = 187 Score = 46 bits (107), Expect = 4e-006 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 188 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLV 60 ++KQRRM+ NRESA RSR RKQ + EL S V L EN +L+ Sbjct: 73 ERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLL 115 >TAIR9_protein||AT2G04038.1 | Symbols: AtbZIP48 | AtbZIP48 (Arabidopsis thaliana basic leucine-zipper 48); DNA binding / transcription factor | chr2:1331919-1332419 FORWARD Length = 167 Score = 45 bits (106), Expect = 6e-006 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 188 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLV 60 ++KQRRM+ NRESA RSR RKQ + EL S V +L EN L+ Sbjct: 73 ERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLI 115 >TAIR9_protein||AT5G38800.1 | Symbols: AtbZIP43 | AtbZIP43 (Arabidopsis thaliana basic leucine-zipper 43); DNA binding / transcription factor | chr5:15538305-15538802 REVERSE Length = 166 Score = 45 bits (106), Expect = 6e-006 Identities = 27/61 (44%), Positives = 38/61 (62%) Frame = -1 Query: 188 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEAEQKKERYKKLMEN 9 ++KQ+R I NRESA RSR RKQ EL S V L +EN +L+R+ + + K + EN Sbjct: 71 ERKQKRKISNRESARRSRMRKQRQVDELWSQVMWLRDENHQLLRKLNCVLESQEKVIEEN 130 Query: 8 L 6 + Sbjct: 131 V 131 >TAIR9_protein||AT1G13600.1 | Symbols: AtbZIP58 | AtbZIP58 (Arabidopsis thaliana basic leucine-zipper 58); DNA binding / protein heterodimerization/ protein homodimerization/ transcription factor | chr1:4650787-4651377 REVERSE Length = 197 Score = 45 bits (104), Expect = 1e-005 Identities = 27/60 (45%), Positives = 35/60 (58%) Frame = -1 Query: 188 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVREEAEQKKERYKKLMEN 9 ++KQRRMI NRESA RSR RKQ + EL S V +L +N L+ + + L EN Sbjct: 85 ERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLMDKLNRVSESHELALKEN 144 >TAIR9_protein||AT5G24800.1 | Symbols: ATBZIP9, BZO2H2, BZIP9 | BZIP9 (BASIC LEUCINE ZIPPER 9); DNA binding / protein heterodimerization/ transcription factor | chr5:8515259-8516541 FORWARD Length = 278 Score = 45 bits (104), Expect = 1e-005 Identities = 22/41 (53%), Positives = 29/41 (70%) Frame = -1 Query: 176 RRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLVRE 54 RRM NRESA RSR RKQ Y V+LE+ V L+ +N+ L ++ Sbjct: 125 RRMNSNRESAKRSRRRKQEYLVDLETQVDSLKGDNSTLYKQ 165 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,143,694,496 Number of Sequences: 33410 Number of Extensions: 3143694496 Number of Successful Extensions: 171315246 Number of sequences better than 0.0: 0 |