BLASTX 7.6.2 Query= RU18358 /QuerySize=179 (178 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G38890.1 | Symbols: | dihydrouridine synthase... 59 7e-010 >TAIR9_protein||AT4G38890.1 | Symbols: | dihydrouridine synthase family protein | chr4:18135909-18139100 REVERSE Length = 701 Score = 59 bits (140), Expect = 7e-010 Identities = 27/57 (47%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = +1 Query: 4 EEIEGECPFMAIDEPCPYGLSCRFLGTHKNGVADGDVNARRRSSEMNGLSKNVQKLL 174 ++IEG+CPF+A C YGLSCRFLG+H++ + D + SEMN +K Q+LL Sbjct: 142 DDIEGQCPFVASGMKCAYGLSCRFLGSHRDITGNSD---DKEKSEMNFFNKETQRLL 195 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,205,020,270 Number of Sequences: 33410 Number of Extensions: 3205020270 Number of Successful Extensions: 176401124 Number of sequences better than 0.0: 0 |