BLASTX 7.6.2 Query= RU19715 /QuerySize=249 (248 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G43260.1 | Symbols: | chaperone protein dnaJ-... 92 5e-020 >TAIR9_protein||AT5G43260.1 | Symbols: | chaperone protein dnaJ-related | chr5:17357693-17357986 REVERSE Length = 98 Score = 92 bits (227), Expect = 5e-020 Identities = 40/55 (72%), Positives = 47/55 (85%), Gaps = 1/55 (1%) Frame = +2 Query: 86 PIVLTQIAQGLGVLAGAAIVKSLMD-KPMAGPFPRCPSCNGTGRVSCLCKRWSDG 247 PIV+TQ+A G+ VLAGA +KS+MD KPMAG FPRCP+CNGTGRV+C C RWSDG Sbjct: 3 PIVITQLATGISVLAGAVFIKSVMDQKPMAGQFPRCPTCNGTGRVTCFCSRWSDG 57 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,444,325,396 Number of Sequences: 33410 Number of Extensions: 3444325396 Number of Successful Extensions: 191925846 Number of sequences better than 0.0: 0 |