BLASTX 7.6.2 Query= RU20461 /QuerySize=818 (817 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G61380.1 | Symbols: TOC1, APRR1, PRR1 | TOC1 (... 112 2e-025 TAIR9_protein||AT5G02810.1 | Symbols: PRR7, APRR7 | PRR7 (PSEUDO... 80 1e-015 TAIR9_protein||AT2G46790.2 | Symbols: APRR9, PRR9, TL1 | APRR9 (... 77 9e-015 TAIR9_protein||AT2G46670.1 | Symbols: | pseudo-response regulat... 77 9e-015 TAIR9_protein||AT2G46790.1 | Symbols: APRR9, PRR9, TL1 | APRR9 (... 77 9e-015 TAIR9_protein||AT5G24470.1 | Symbols: APRR5, PRR5 | APRR5 (ARABI... 74 1e-013 TAIR9_protein||AT5G60100.1 | Symbols: APRR3, PRR3 | APRR3 (ARABI... 73 2e-013 TAIR9_protein||AT4G25990.1 | Symbols: CIL | CIL | chr4:13191937-... 55 6e-008 TAIR9_protein||AT1G49130.1 | Symbols: | zinc finger (B-box type... 54 8e-008 TAIR9_protein||AT1G49130.2 | Symbols: | zinc finger (B-box type... 54 8e-008 TAIR9_protein||AT5G57180.2 | Symbols: CIA2 | CIA2 (CHLOROPLAST I... 54 8e-008 TAIR9_protein||AT5G14370.1 | Symbols: | LOCATED IN: chloroplast... 54 8e-008 TAIR9_protein||AT5G15840.1 | Symbols: CO, FG | CO (CONSTANS); tr... 54 1e-007 TAIR9_protein||AT1G07050.1 | Symbols: | CONSTANS-like protein-r... 53 2e-007 TAIR9_protein||AT1G73870.1 | Symbols: | zinc finger (B-box type... 53 2e-007 TAIR9_protein||AT1G25440.1 | Symbols: | zinc finger (B-box type... 52 3e-007 TAIR9_protein||AT1G68520.1 | Symbols: | zinc finger (B-box type... 52 4e-007 TAIR9_protein||AT1G51600.1 | Symbols: ZML2, TIFY2A | TIFY2A; seq... 50 2e-006 TAIR9_protein||AT1G51600.2 | Symbols: ZML2, TIFY2A | TIFY2A; seq... 50 2e-006 TAIR9_protein||AT2G33350.1 | Symbols: | FUNCTIONS IN: molecular... 49 3e-006 TAIR9_protein||AT2G33350.2 | Symbols: | FUNCTIONS IN: molecular... 49 3e-006 TAIR9_protein||AT1G04500.1 | Symbols: | zinc finger CONSTANS-re... 49 3e-006 TAIR9_protein||AT1G63820.1 | Symbols: | INVOLVED IN: biological... 48 6e-006 TAIR9_protein||AT3G12890.1 | Symbols: ASML2 | ASML2 (ACTIVATOR O... 47 1e-005 >TAIR9_protein||AT5G61380.1 | Symbols: TOC1, APRR1, PRR1 | TOC1 (TIMING OF CAB EXPRESSION 1); transcription regulator/ two-component response regulator | chr5:24675540-24678176 FORWARD Length = 619 Score = 112 bits (280), Expect = 2e-025 Identities = 52/65 (80%), Positives = 62/65 (95%) Frame = -1 Query: 817 VKLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVDVDLN 638 V+++K+DRRE AL+KFR+KR +RCFDKKIRYVNRKRLAERRPRV+GQFVRK+NGV+VDLN Sbjct: 525 VRVNKLDRREEALLKFRRKRNQRCFDKKIRYVNRKRLAERRPRVKGQFVRKMNGVNVDLN 584 Query: 637 GQPAS 623 GQP S Sbjct: 585 GQPDS 589 >TAIR9_protein||AT5G02810.1 | Symbols: PRR7, APRR7 | PRR7 (PSEUDO-RESPONSE REGULATOR 7); transcription regulator/ two-component response regulator | chr5:638283-641461 REVERSE Length = 728 Score = 80 bits (197), Expect = 1e-015 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -1 Query: 808 SKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 +K+ +REAAL KFRQKRKERCF KK+RY +RK+LAE+RPRVRGQFVRK Sbjct: 664 NKISQREAALTKFRQKRKERCFRKKVRYQSRKKLAEQRPRVRGQFVRK 711 >TAIR9_protein||AT2G46790.2 | Symbols: APRR9, PRR9, TL1 | APRR9 (ARABIDOPSIS PSEUDO-RESPONSE REGULATOR 9); protein binding / transcription regulator/ two-component response regulator | chr2:19233422-19234901 FORWARD Length = 352 Score = 77 bits (189), Expect = 9e-015 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 796 RREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 +REAAL+KFR KRK+RCFDKK+RY +RK+LAE+RPRV+GQFVR VN Sbjct: 299 QREAALMKFRLKRKDRCFDKKVRYQSRKKLAEQRPRVKGQFVRTVN 344 >TAIR9_protein||AT2G46670.1 | Symbols: | pseudo-response regulator, putative / timing of CAB expression 1-like protein, putative | chr2:19164589-19165233 REVERSE Length = 184 Score = 77 bits (189), Expect = 9e-015 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 796 RREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 +REAAL+KFR KRK+RCFDKK+RY +RK+LAE+RPRV+GQFVR VN Sbjct: 131 QREAALMKFRLKRKDRCFDKKVRYQSRKKLAEQRPRVKGQFVRTVN 176 >TAIR9_protein||AT2G46790.1 | Symbols: APRR9, PRR9, TL1 | APRR9 (ARABIDOPSIS PSEUDO-RESPONSE REGULATOR 9); protein binding / transcription regulator/ two-component response regulator | chr2:19232874-19234901 FORWARD Length = 469 Score = 77 bits (189), Expect = 9e-015 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 796 RREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 +REAAL+KFR KRK+RCFDKK+RY +RK+LAE+RPRV+GQFVR VN Sbjct: 416 QREAALMKFRLKRKDRCFDKKVRYQSRKKLAEQRPRVKGQFVRTVN 461 >TAIR9_protein||AT5G24470.1 | Symbols: APRR5, PRR5 | APRR5 (ARABIDOPSIS PSEUDO-RESPONSE REGULATOR 5); transcription regulator/ two-component response regulator | chr5:8356204-8358873 REVERSE Length = 668 Score = 74 bits (179), Expect = 1e-013 Identities = 32/51 (62%), Positives = 45/51 (88%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKV 662 K+ + +REAAL KFR KRK+RC++KK+RY +RK+LAE+RPR++GQFVR+V Sbjct: 611 KIQQSLQREAALTKFRMKRKDRCYEKKVRYESRKKLAEQRPRIKGQFVRQV 661 >TAIR9_protein||AT5G60100.1 | Symbols: APRR3, PRR3 | APRR3 (ARABIDOPSIS PSEUDO-RESPONSE REGULATOR 3); transcription regulator/ two-component response regulator | chr5:24198215-24200502 REVERSE Length = 496 Score = 73 bits (177), Expect = 2e-013 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = -1 Query: 796 RREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 +REAAL+KFR KRKERCF+KK+RY +RK+LAE+RP V+GQF+RK Sbjct: 441 QREAALMKFRLKRKERCFEKKVRYHSRKKLAEQRPHVKGQFIRK 484 >TAIR9_protein||AT4G25990.1 | Symbols: CIL | CIL | chr4:13191937-13193543 REVERSE Length = 395 Score = 55 bits (130), Expect = 6e-008 Identities = 23/45 (51%), Positives = 37/45 (82%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 REA+++++++KR+ R F KKIRY RK A++RPR++G+FVR+ N Sbjct: 341 REASVLRYKEKRRNRLFSKKIRYQVRKLNADQRPRMKGRFVRRPN 385 >TAIR9_protein||AT1G49130.1 | Symbols: | zinc finger (B-box type) family protein | chr1:18174741-18175936 REVERSE Length = 327 Score = 54 bits (129), Expect = 8e-008 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVD 650 REA + ++R KRK R F+KKIRY RK A++RPR++G+FVR+ +D Sbjct: 278 REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRSLAID 325 >TAIR9_protein||AT1G49130.2 | Symbols: | zinc finger (B-box type) family protein | chr1:18174741-18175811 REVERSE Length = 320 Score = 54 bits (129), Expect = 8e-008 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVD 650 REA + ++R KRK R F+KKIRY RK A++RPR++G+FVR+ +D Sbjct: 271 REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRSLAID 318 >TAIR9_protein||AT5G57180.2 | Symbols: CIA2 | CIA2 (CHLOROPLAST IMPORT APPARATUS 2); transcription regulator | chr5:23168393-23170763 FORWARD Length = 436 Score = 54 bits (129), Expect = 8e-008 Identities = 23/45 (51%), Positives = 37/45 (82%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 REA+++++++KR+ R F KKIRY RK A++RPR++G+FVR+ N Sbjct: 383 REASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRRPN 427 >TAIR9_protein||AT5G14370.1 | Symbols: | LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: CCT domain (InterPro:IPR010402); BEST Arabidopsis thaliana protein match is: CIL (TAIR:AT4G25990.1); Has 1815 Blast hits to 1506 proteins in 139 species: Archae - 0; Bacteria - 8; Metazoa - 291; Fungi - 53; Plants - 1145; Viruses - 0; Other Eukaryotes - 318 (source: NCBI BLink). | chr5:4632147-4633651 REVERSE Length = 340 Score = 54 bits (129), Expect = 8e-008 Identities = 23/43 (53%), Positives = 36/43 (83%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 REA+L+++++KR+ R F K+IRY RK AE+RPRV+G+FV++ Sbjct: 294 REASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRVKGRFVKR 336 >TAIR9_protein||AT5G15840.1 | Symbols: CO, FG | CO (CONSTANS); transcription factor/ transcription regulator/ zinc ion binding | chr5:5171343-5172697 REVERSE Length = 374 Score = 54 bits (128), Expect = 1e-007 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 +LS +D REA ++++R+KRK R F+K IRY +RK AE RPRV G+F ++ Sbjct: 300 QLSPMD-REARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKR 348 >TAIR9_protein||AT1G07050.1 | Symbols: | CONSTANS-like protein-related | chr1:2164327-2165133 REVERSE Length = 196 Score = 53 bits (126), Expect = 2e-007 Identities = 22/44 (50%), Positives = 36/44 (81%) Frame = -1 Query: 796 RREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 RREA+++++++KR+ R F KKIRY RK A++RPR +G+FV++ Sbjct: 150 RREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKR 193 >TAIR9_protein||AT1G73870.1 | Symbols: | zinc finger (B-box type) family protein | chr1:27779214-27780522 FORWARD Length = 393 Score = 53 bits (126), Expect = 2e-007 Identities = 22/45 (48%), Positives = 36/45 (80%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 REA ++++++KR+ R F KKIRY RK AE+RPR++G+FV++ + Sbjct: 345 REARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRTS 389 >TAIR9_protein||AT1G25440.1 | Symbols: | zinc finger (B-box type) family protein | chr1:8933939-8935284 REVERSE Length = 418 Score = 52 bits (124), Expect = 3e-007 Identities = 23/45 (51%), Positives = 35/45 (77%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRKVN 659 REA + ++R+KR+ R F KKIRY RK AE+RPR++G+FV++ + Sbjct: 361 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS 405 >TAIR9_protein||AT1G68520.1 | Symbols: | zinc finger (B-box type) family protein | chr1:25709331-25710749 REVERSE Length = 407 Score = 52 bits (123), Expect = 4e-007 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -1 Query: 793 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 665 REA + ++R+KR+ R F KKIRY RK AE+RPR++G+FV++ Sbjct: 357 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR 399 >TAIR9_protein||AT1G51600.1 | Symbols: ZML2, TIFY2A | TIFY2A; sequence-specific DNA binding / transcription factor/ zinc ion binding | chr1:19133176-19135252 FORWARD Length = 303 Score = 50 bits (118), Expect = 2e-006 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = -1 Query: 802 VDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQF 674 + +R A+L++FR+KRK R FDKKIRY RK +A R R +GQF Sbjct: 144 IPQRLASLVRFREKRKGRNFDKKIRYTVRKEVALRMQRNKGQF 186 >TAIR9_protein||AT1G51600.2 | Symbols: ZML2, TIFY2A | TIFY2A; sequence-specific DNA binding / transcription factor/ zinc ion binding | chr1:19133176-19135252 FORWARD Length = 303 Score = 50 bits (118), Expect = 2e-006 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = -1 Query: 802 VDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQF 674 + +R A+L++FR+KRK R FDKKIRY RK +A R R +GQF Sbjct: 144 IPQRLASLVRFREKRKGRNFDKKIRYTVRKEVALRMQRNKGQF 186 >TAIR9_protein||AT2G33350.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 7 plant structures; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage, 4 anthesis; CONTAINS InterPro DOMAIN/s: CCT domain (InterPro:IPR010402); BEST Arabidopsis thaliana protein match is: zinc finger CONSTANS-related (TAIR:AT1G04500.1); Has 7691 Blast hits to 4729 proteins in 129 species: Archae - 8; Bacteria - 25; Metazoa - 148; Fungi - 114; Plants - 918; Viruses - 0; Other Eukaryotes - 6478 (source: NCBI BLink). | chr2:14134116-14136836 FORWARD Length = 411 Score = 49 bits (116), Expect = 3e-006 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVR 668 KLS R+E + ++ +KR ER F+KKI+Y RK LA+ RPRVRG+F + Sbjct: 305 KLSPEQRKE-KIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAK 352 >TAIR9_protein||AT2G33350.2 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 7 plant structures; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage, 4 anthesis; CONTAINS InterPro DOMAIN/s: CCT domain (InterPro:IPR010402); BEST Arabidopsis thaliana protein match is: zinc finger CONSTANS-related (TAIR:AT1G04500.1); Has 7688 Blast hits to 4734 proteins in 129 species: Archae - 8; Bacteria - 25; Metazoa - 148; Fungi - 118; Plants - 919; Viruses - 0; Other Eukaryotes - 6470 (source: NCBI BLink). | chr2:14134116-14136836 FORWARD Length = 410 Score = 49 bits (116), Expect = 3e-006 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVR 668 KLS R+E + ++ +KR ER F+KKI+Y RK LA+ RPRVRG+F + Sbjct: 304 KLSPEQRKE-KIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAK 351 >TAIR9_protein||AT1G04500.1 | Symbols: | zinc finger CONSTANS-related | chr1:1221757-1224235 REVERSE Length = 387 Score = 49 bits (115), Expect = 3e-006 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%) Frame = -1 Query: 814 KLSKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVR 668 KLS R+E + ++ +KR ER F KKI+Y RK LA+ RPRVRG+F + Sbjct: 282 KLSAEQRKE-KIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAK 329 >TAIR9_protein||AT1G63820.1 | Symbols: | INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: flower, root; EXPRESSED DURING: petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: CCT domain (InterPro:IPR010402); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G41380.1); Has 907 Blast hits to 907 proteins in 64 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 0; Plants - 882; Viruses - 0; Other Eukaryotes - 24 (source: NCBI BLink). | chr1:23682529-23684050 REVERSE Length = 294 Score = 48 bits (113), Expect = 6e-006 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = -1 Query: 799 DRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVR 668 + R+ + K+R KR +R F K I+Y RK LA+ RPRVRG+F R Sbjct: 190 EERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRPRVRGRFAR 233 >TAIR9_protein||AT3G12890.1 | Symbols: ASML2 | ASML2 (ACTIVATOR OF SPOMIN::LUC2); transcription activator | chr3:4099223-4100277 FORWARD Length = 252 Score = 47 bits (111), Expect = 1e-005 Identities = 21/45 (46%), Positives = 34/45 (75%) Frame = -1 Query: 802 VDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVR 668 V+ R+ ++++ +K+ +R F+K I+YV RK LA+RR RVRG+F R Sbjct: 136 VEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFAR 180 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,532,527,449 Number of Sequences: 33410 Number of Extensions: 3532527449 Number of Successful Extensions: 192026384 Number of sequences better than 0.0: 0 |