BLASTX 7.6.2 Query= RU20741 /QuerySize=340 (339 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G20860.1 | Symbols: LIP1 | LIP1 (LIPOIC ACID S... 99 5e-022 >TAIR9_protein||AT2G20860.1 | Symbols: LIP1 | LIP1 (LIPOIC ACID SYNTHASE 1); lipoic acid synthase | chr2:8979636-8980983 FORWARD Length = 375 Score = 99 bits (244), Expect = 5e-022 Identities = 47/59 (79%), Positives = 54/59 (91%), Gaps = 1/59 (1%) Frame = -3 Query: 178 LRARLAAESPTLTEFVEGEGPYSVEVGTKKKPLPKPRWMKESIPGGEKYTQIKKKLREL 2 LRARLA ESP+LT+F+ G+ YSVEVGTKKKPLPKP+WMKESIPGGE+Y QIKKKLR+L Sbjct: 40 LRARLANESPSLTDFIHGD-TYSVEVGTKKKPLPKPKWMKESIPGGERYVQIKKKLRDL 97 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,590,698,424 Number of Sequences: 33410 Number of Extensions: 3590698424 Number of Successful Extensions: 197135522 Number of sequences better than 0.0: 0 |