BLASTX 7.6.2 Query= RU21291 /QuerySize=571 (570 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G22550.1 | Symbols: | phosphatidic acid phosp... 54 6e-008 >TAIR9_protein||AT4G22550.1 | Symbols: | phosphatidic acid phosphatase-related / PAP2-related | chr4:11878255-11878896 REVERSE Length = 214 Score = 54 bits (128), Expect = 6e-008 Identities = 26/39 (66%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +2 Query: 287 IKFTVRRARPVYN-KNMNVAVSVDHFSFPSGHASRVCFV 400 +K RRARP YN +M+ AVS DH+SFPSGHASRV FV Sbjct: 83 VKLIFRRARPAYNHPSMSAAVSADHYSFPSGHASRVFFV 121 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,709,709,958 Number of Sequences: 33410 Number of Extensions: 3709709958 Number of Successful Extensions: 207080749 Number of sequences better than 0.0: 0 |