BLASTX 7.6.2 Query= RU21365 /QuerySize=414 (413 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G48385.1 | Symbols: | FUNCTIONS IN: molecular... 110 3e-025 >TAIR9_protein||AT5G48385.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Frigida-like (InterPro:IPR012474); BEST Arabidopsis thaliana protein match is: hydroxyproline-rich glycoprotein family protein (TAIR:AT3G22440.1); Has 987 Blast hits to 921 proteins in 78 species: Archae - 0; Bacteria - 16; Metazoa - 58; Fungi - 7; Plants - 873; Viruses - 0; Other Eukaryotes - 33 (source: NCBI BLink). | chr5:19609471-19611712 FORWARD Length = 559 Score = 110 bits (274), Expect = 3e-025 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +2 Query: 227 MEDTHSVSTLIDSTTSKIHQLQKAFAELEGHRAVTLNLKWKELEEHFHGLEKSLKRRFHE 406 MEDT SV++L+DST+SKI QLQKAFAELE RAVTLNLKWKELEEHFHGLE+SLKRRFHE Sbjct: 1 MEDTRSVASLMDSTSSKIQQLQKAFAELESQRAVTLNLKWKELEEHFHGLERSLKRRFHE 60 Query: 407 LE 412 LE Sbjct: 61 LE 62 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,709,709,958 Number of Sequences: 33410 Number of Extensions: 3709709958 Number of Successful Extensions: 207080749 Number of sequences better than 0.0: 0 |