BLASTX 7.6.2 Query= RU22458 /QuerySize=187 (186 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G17210.1 | Symbols: ATHS1, HS1 | HS1 (HEAT STA... 85 9e-018 TAIR9_protein||AT5G22580.1 | Symbols: | FUNCTIONS IN: molecular... 48 1e-006 >TAIR9_protein||AT3G17210.1 | Symbols: ATHS1, HS1 | HS1 (HEAT STABLE PROTEIN 1) | chr3:5882318-5882896 FORWARD Length = 110 Score = 85 bits (208), Expect = 9e-018 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +1 Query: 34 AKGVVKHVVLAKFKEGVSESQIDQLIKGYANLVNLIDPMESFHWGKDLSIE 186 AKG VKHV+LA FK+GVS +I++LIKGYANLVNLI+PM++FHWGKD+SIE Sbjct: 4 AKGPVKHVLLASFKDGVSPEKIEELIKGYANLVNLIEPMKAFHWGKDVSIE 54 >TAIR9_protein||AT5G22580.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Stress responsive alpha-beta barrel (InterPro:IPR013097), Dimeric alpha-beta barrel (InterPro:IPR011008); BEST Arabidopsis thaliana protein match is: HS1 (HEAT STABLE PROTEIN 1) (TAIR:AT3G17210.1); Has 231 Blast hits to 231 proteins in 57 species: Archae - 0; Bacteria - 89; Metazoa - 0; Fungi - 4; Plants - 98; Viruses - 0; Other Eukaryotes - 40 (source: NCBI BLink). | chr5:7502709-7503137 FORWARD Length = 112 Score = 48 bits (112), Expect = 1e-006 Identities = 20/42 (47%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = +1 Query: 49 KHVVLAKFKEGVSESQIDQLIKGYANLVNLIDPMESFHWGKD 174 KH+V+ KFKE ++++D+++KG NLV+ ID ++SF WG+D Sbjct: 7 KHLVVVKFKE---DTKVDEILKGLENLVSQIDTVKSFEWGED 45 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,884,545,436 Number of Sequences: 33410 Number of Extensions: 3884545436 Number of Successful Extensions: 217906452 Number of sequences better than 0.0: 0 |