BLASTX 7.6.2 Query= RU22716 /QuerySize=547 (546 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G40650.1 | Symbols: | pre-mRNA splicing facto... 101 3e-022 >TAIR9_protein||AT2G40650.1 | Symbols: | pre-mRNA splicing factor PRP38 family protein | chr2:16963588-16965596 REVERSE Length = 356 Score = 101 bits (251), Expect = 3e-022 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = +1 Query: 109 AETLVDKAMELDHIGGIFGGNRKPTPFMCLVMKVLQIQSEKEIVIEFIKNDDYK 270 AETLVDKAMELDH+GG FGG+RKPTPF+CL++K+LQIQ EKEIV+EFIKNDDYK Sbjct: 44 AETLVDKAMELDHLGGTFGGSRKPTPFLCLILKMLQIQPEKEIVVEFIKNDDYK 97 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,913,704,617 Number of Sequences: 33410 Number of Extensions: 3913704617 Number of Successful Extensions: 217960510 Number of sequences better than 0.0: 0 |