BLASTX 7.6.2 Query= RU22986 /QuerySize=670 (669 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G28910.2 | Symbols: | LOCATED IN: cellular_co... 50 1e-006 TAIR9_protein||AT4G28910.1 | Symbols: | LOCATED IN: cellular_co... 50 1e-006 TAIR9_protein||AT4G28910.3 | Symbols: | LOCATED IN: cellular_co... 50 1e-006 >TAIR9_protein||AT4G28910.2 | Symbols: | LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1675 (InterPro:IPR012463); BEST Arabidopsis thaliana protein match is: nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (TAIR:AT3G07250.1); Has 223 Blast hits to 204 proteins in 56 species: Archae - 2; Bacteria - 11; Metazoa - 48; Fungi - 32; Plants - 89; Viruses - 3; Other Eukaryotes - 38 (source: NCBI BLink). | chr4:14264330-14265680 REVERSE Length = 426 Score = 50 bits (117), Expect = 1e-006 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = +3 Query: 519 EERQTDAGNKRKTLFEEMNQQKKHEREAHYTDMHD-KTRASHIS-ITEDGS 665 +E + +AGNKRK F MN KK E+++ + DMH+ KT+ASH+S T++GS Sbjct: 106 DESRKEAGNKRKFGFPGMNDDKKKEKDSSHVDMHEKKTKASHVSTATDEGS 156 >TAIR9_protein||AT4G28910.1 | Symbols: | LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1675 (InterPro:IPR012463); BEST Arabidopsis thaliana protein match is: nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (TAIR:AT3G07250.1); Has 223 Blast hits to 204 proteins in 56 species: Archae - 2; Bacteria - 11; Metazoa - 48; Fungi - 32; Plants - 89; Viruses - 3; Other Eukaryotes - 38 (source: NCBI BLink). | chr4:14264330-14265680 REVERSE Length = 426 Score = 50 bits (117), Expect = 1e-006 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = +3 Query: 519 EERQTDAGNKRKTLFEEMNQQKKHEREAHYTDMHD-KTRASHIS-ITEDGS 665 +E + +AGNKRK F MN KK E+++ + DMH+ KT+ASH+S T++GS Sbjct: 106 DESRKEAGNKRKFGFPGMNDDKKKEKDSSHVDMHEKKTKASHVSTATDEGS 156 >TAIR9_protein||AT4G28910.3 | Symbols: | LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1675 (InterPro:IPR012463); BEST Arabidopsis thaliana protein match is: nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (TAIR:AT3G07250.1); Has 223 Blast hits to 204 proteins in 56 species: Archae - 2; Bacteria - 11; Metazoa - 48; Fungi - 32; Plants - 89; Viruses - 3; Other Eukaryotes - 38 (source: NCBI BLink). | chr4:14264330-14265680 REVERSE Length = 426 Score = 50 bits (117), Expect = 1e-006 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = +3 Query: 519 EERQTDAGNKRKTLFEEMNQQKKHEREAHYTDMHD-KTRASHIS-ITEDGS 665 +E + +AGNKRK F MN KK E+++ + DMH+ KT+ASH+S T++GS Sbjct: 106 DESRKEAGNKRKFGFPGMNDDKKKEKDSSHVDMHEKKTKASHVSTATDEGS 156 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,971,710,044 Number of Sequences: 33410 Number of Extensions: 3971710044 Number of Successful Extensions: 218040509 Number of sequences better than 0.0: 0 |