BLASTX 7.6.2 Query= RU23116 /QuerySize=312 (311 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G02810.1 | Symbols: PRR7, APRR7 | PRR7 (PSEUDO... 51 1e-007 >TAIR9_protein||AT5G02810.1 | Symbols: PRR7, APRR7 | PRR7 (PSEUDO-RESPONSE REGULATOR 7); transcription regulator/ two-component response regulator | chr5:638283-641461 REVERSE Length = 728 Score = 51 bits (120), Expect = 1e-007 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = +2 Query: 152 SSSPIDSRGEKEGTISPIEVGSKSGVDQNHVSKREAALNRFRQKRKERCFDKK 310 S + G +G+ S GS + D+N +S+REAAL +FRQKRKERCF KK Sbjct: 636 SDNGAGKNGNGDGSGSGSGSGSGNLADENKISQREAALTKFRQKRKERCFRKK 688 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,971,710,044 Number of Sequences: 33410 Number of Extensions: 3971710044 Number of Successful Extensions: 218040509 Number of sequences better than 0.0: 0 |