BLASTX 7.6.2 Query= RU23600 /QuerySize=575 (574 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G22580.1 | Symbols: | FUNCTIONS IN: molecular... 136 9e-033 >TAIR9_protein||AT5G22580.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Stress responsive alpha-beta barrel (InterPro:IPR013097), Dimeric alpha-beta barrel (InterPro:IPR011008); BEST Arabidopsis thaliana protein match is: HS1 (HEAT STABLE PROTEIN 1) (TAIR:AT3G17210.1); Has 231 Blast hits to 231 proteins in 57 species: Archae - 0; Bacteria - 89; Metazoa - 0; Fungi - 4; Plants - 98; Viruses - 0; Other Eukaryotes - 40 (source: NCBI BLink). | chr5:7502709-7503137 FORWARD Length = 112 Score = 136 bits (342), Expect = 9e-033 Identities = 64/99 (64%), Positives = 75/99 (75%) Frame = +1 Query: 22 FKHLVIVKFKADVVVEEILTGLEKLVAEIDAVKSYEWGQDLESQEMLTQGFTHAILMTFD 201 FKHLV+VKFK D V+EIL GLE LV++ID VKS+EWG+D ES +ML QGFTHA MTF+ Sbjct: 6 FKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFE 65 Query: 202 KKEDYTLFLSHPKHAEFSGTFSTVIEKIVLLDFPATLVK 318 K+ Y F SHP H EFS F+ VI+KIVLLDFP VK Sbjct: 66 NKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVK 104 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,059,965,137 Number of Sequences: 33410 Number of Extensions: 4059965137 Number of Successful Extensions: 224407966 Number of sequences better than 0.0: 0 |