BLASTX 7.6.2 Query= RU23774 /QuerySize=454 (453 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G02420.1 | Symbols: | unknown protein | chr3:... 115 1e-026 >TAIR9_protein||AT3G02420.1 | Symbols: | unknown protein | chr3:496179-498772 REVERSE Length = 349 Score = 115 bits (287), Expect = 1e-026 Identities = 50/69 (72%), Positives = 61/69 (88%) Frame = +3 Query: 123 MGEERDDPQKLKKIAAAAYDYENDPRWADYWANILIPPHMASSPDVIGHFKQKFYKRYID 302 M E +D Q+LKKIAAAA+DYEND RWADYW+NILIPPHMAS P+V+ HFK+KFY+RYID Sbjct: 1 MAEGGEDSQRLKKIAAAAFDYENDARWADYWSNILIPPHMASRPEVVDHFKRKFYQRYID 60 Query: 303 PELLVDAMS 329 P+L+V+ MS Sbjct: 61 PDLVVEPMS 69 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,087,783,227 Number of Sequences: 33410 Number of Extensions: 4087783227 Number of Successful Extensions: 224564999 Number of sequences better than 0.0: 0 |