BLASTX 7.6.2 Query= RU23838 /QuerySize=249 (248 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G55640.1 | Symbols: | unknown protein | chr5:... 46 4e-006 >TAIR9_protein||AT5G55640.1 | Symbols: | unknown protein | chr5:22533244-22533923 REVERSE Length = 150 Score = 46 bits (107), Expect = 4e-006 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = -2 Query: 124 KTQNLPSPKDKKEENIYLGPHGAPRSQSKQQEVNSSSHQ 8 +T SPK K EENIYLGPHGAP SQ + N+SS + Sbjct: 45 ETSKPSSPKSKAEENIYLGPHGAPPSQLQDGGSNTSSRK 83 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,116,082,589 Number of Sequences: 33410 Number of Extensions: 4116082589 Number of Successful Extensions: 224650338 Number of sequences better than 0.0: 0 |