BLASTX 7.6.2 Query= RU24197 /QuerySize=258 (257 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G05000.1 | Symbols: | tyrosine specific prote... 64 2e-011 TAIR9_protein||AT1G05000.2 | Symbols: | tyrosine specific prote... 64 2e-011 TAIR9_protein||AT2G32960.1 | Symbols: | tyrosine specific prote... 60 3e-010 TAIR9_protein||AT4G03960.1 | Symbols: | tyrosine specific prote... 59 7e-010 TAIR9_protein||AT3G02800.1 | Symbols: | phosphatase/ phosphopro... 47 2e-006 >TAIR9_protein||AT1G05000.1 | Symbols: | tyrosine specific protein phosphatase family protein | chr1:1425660-1428393 FORWARD Length = 216 Score = 64 bits (154), Expect = 2e-011 Identities = 37/69 (53%), Positives = 43/69 (62%), Gaps = 5/69 (7%) Frame = +2 Query: 65 DEMCRTI----EVVGGVHPSPXXXXXXSDGECADDL-FIPPLNFAMVDNGIFRSGFPDSN 229 ++ CRTI EV V +P ++L IPPLNF+MVDNGIFRSGFPDS Sbjct: 16 EDFCRTIIEVSEVNRNVFQAPGGEADPFRVVSGEELHLIPPLNFSMVDNGIFRSGFPDSA 75 Query: 230 NLSFLQTLG 256 N SFLQTLG Sbjct: 76 NFSFLQTLG 84 >TAIR9_protein||AT1G05000.2 | Symbols: | tyrosine specific protein phosphatase family protein | chr1:1425660-1428393 FORWARD Length = 248 Score = 64 bits (154), Expect = 2e-011 Identities = 37/69 (53%), Positives = 43/69 (62%), Gaps = 5/69 (7%) Frame = +2 Query: 65 DEMCRTI----EVVGGVHPSPXXXXXXSDGECADDL-FIPPLNFAMVDNGIFRSGFPDSN 229 ++ CRTI EV V +P ++L IPPLNF+MVDNGIFRSGFPDS Sbjct: 16 EDFCRTIIEVSEVNRNVFQAPGGEADPFRVVSGEELHLIPPLNFSMVDNGIFRSGFPDSA 75 Query: 230 NLSFLQTLG 256 N SFLQTLG Sbjct: 76 NFSFLQTLG 84 >TAIR9_protein||AT2G32960.1 | Symbols: | tyrosine specific protein phosphatase family protein | chr2:13987976-13990720 FORWARD Length = 258 Score = 60 bits (143), Expect = 3e-010 Identities = 35/68 (51%), Positives = 40/68 (58%), Gaps = 5/68 (7%) Frame = +2 Query: 68 EMCRTIEVV----GGVHPSPXXXXXXSDGECADDL-FIPPLNFAMVDNGIFRSGFPDSNN 232 E+ TIEV V P D+L IPPLNF+MVDNGIFRSGFPDS N Sbjct: 25 ELFHTIEVAKVDRNNVSQPPPAATAALLEVPGDELNLIPPLNFSMVDNGIFRSGFPDSAN 84 Query: 233 LSFLQTLG 256 SF++TLG Sbjct: 85 FSFIKTLG 92 >TAIR9_protein||AT4G03960.1 | Symbols: | tyrosine specific protein phosphatase family protein | chr4:1887673-1889000 FORWARD Length = 199 Score = 59 bits (140), Expect = 7e-010 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +2 Query: 95 GGVHPSPXXXXXXSDGECADDLFIPPLNFAMVDNGIFRSGFPDSNNLSFLQTL 253 G VH P + +LF+PPLNFAMVDNGIFRSGFP+ + SFLQ+L Sbjct: 8 GDVHTVPQSENSMEE-RGGGELFVPPLNFAMVDNGIFRSGFPEPVSFSFLQSL 59 >TAIR9_protein||AT3G02800.1 | Symbols: | phosphatase/ phosphoprotein phosphatase/ protein tyrosine phosphatase | chr3:606638-607704 REVERSE Length = 204 Score = 47 bits (111), Expect = 2e-006 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +2 Query: 155 DLFIPPLNFAMVDNGIFRSGFPDSNNLSFLQTL 253 D+ PP NF+MV++GI+RSGFP N SFL+TL Sbjct: 13 DVLAPPSNFSMVEDGIYRSGFPRPENFSFLKTL 45 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,172,003,312 Number of Sequences: 33410 Number of Extensions: 4172003312 Number of Successful Extensions: 224782364 Number of sequences better than 0.0: 0 |