BLASTX 7.6.2 Query= RU24363 /QuerySize=947 (946 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G08770.1 | Symbols: | unknown protein | chr5:... 156 3e-038 >TAIR9_protein||AT5G08770.1 | Symbols: | unknown protein | chr5:2855638-2856531 REVERSE Length = 298 Score = 156 bits (392), Expect = 3e-038 Identities = 82/152 (53%), Positives = 104/152 (68%), Gaps = 12/152 (7%) Frame = +2 Query: 485 FSFTDRSF.LHLRAFVKMSRGLFKLVFAPSECIASDAAS-TESHWNCCSASLFSRLAGDR 661 F S HLR+FV +S GLFKLVF+ + S ++S + S+W+CCS SLFS++A R Sbjct: 147 FPSLSASSLSHLRSFVSLSNGLFKLVFSATTVETSPSSSGSVSNWDCCSVSLFSKIANKR 206 Query: 662 MDTMEGFSRALAGVGWSLFKTKEN-------GGGKSVYLFRKVDVNRVRA----GECRIR 808 + +ME FS ALA GW+++KTKEN G SVYLFRKV R+ G CR+R Sbjct: 207 IGSMESFSNALASKGWTIYKTKENPTPESTTNGVSSVYLFRKVYTGRIMTREGNGSCRVR 266 Query: 809 ELKLPALDFRNAPLRILQYILLMTDDIFYLA* 904 EL+LP LDFRNAPLRILQY++LMTDDIF+LA* Sbjct: 267 ELRLPQLDFRNAPLRILQYLMLMTDDIFFLA* 298 Score = 59 bits (140), Expect = 5e-009 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +3 Query: 222 KSPLLLFLPTKELVTDTYRLATIARDMGMDLHPT 323 K+PLL F+PT+EL++DTYRLATI RD+GMD++PT Sbjct: 61 KTPLLYFVPTRELISDTYRLATIGRDLGMDMYPT 94 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,172,003,312 Number of Sequences: 33410 Number of Extensions: 4172003312 Number of Successful Extensions: 224782364 Number of sequences better than 0.0: 0 |