BLASTX 7.6.2 Query= RU24478 /QuerySize=250 (249 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G27410.2 | Symbols: RD26, ANAC072 | RD26 (RESP... 86 4e-018 TAIR9_protein||AT4G27410.3 | Symbols: RD26 | RD26 (RESPONSIVE TO... 86 4e-018 TAIR9_protein||AT1G52890.1 | Symbols: ANAC019 | ANAC019 (Arabido... 86 5e-018 TAIR9_protein||AT3G15500.1 | Symbols: ATNAC3, ANAC055 | ANAC055 ... 79 4e-016 TAIR9_protein||AT5G17260.1 | Symbols: anac086 | anac086 (Arabido... 50 2e-007 TAIR9_protein||AT3G03200.1 | Symbols: anac045 | anac045 (Arabido... 50 2e-007 TAIR9_protein||AT1G54330.1 | Symbols: ANAC020 | ANAC020 (Arabido... 50 3e-007 TAIR9_protein||AT2G33480.1 | Symbols: ANAC041 | ANAC041 (Arabido... 49 4e-007 TAIR9_protein||AT2G33480.2 | Symbols: ANAC041 | ANAC041 (Arabido... 49 4e-007 TAIR9_protein||AT1G65910.1 | Symbols: anac028 | anac028 (Arabido... 49 5e-007 TAIR9_protein||AT1G01720.1 | Symbols: ATAF1, ANAC002 | ATAF1; tr... 49 5e-007 TAIR9_protein||AT3G18400.1 | Symbols: anac058 | anac058 (Arabido... 49 5e-007 TAIR9_protein||AT2G18060.1 | Symbols: VND1, ANAC037 | VND1 (VASC... 48 9e-007 TAIR9_protein||AT5G08790.1 | Symbols: ATAF2, anac081 | ATAF2; tr... 48 1e-006 TAIR9_protein||AT1G77450.1 | Symbols: anac032 | anac032 (Arabido... 47 2e-006 TAIR9_protein||AT4G17980.1 | Symbols: anac071 | anac071 (Arabido... 47 2e-006 TAIR9_protein||AT5G07680.1 | Symbols: ANAC080, ANAC079, ATNAC4 |... 47 2e-006 TAIR9_protein||AT5G46590.1 | Symbols: anac096 | anac096 (Arabido... 47 2e-006 TAIR9_protein||AT5G13180.1 | Symbols: ANAC083 | ANAC083 (ARABIDO... 47 2e-006 TAIR9_protein||AT3G17730.1 | Symbols: anac057 | anac057 (Arabido... 47 3e-006 TAIR9_protein||AT3G15510.1 | Symbols: ATNAC2, ANAC056, NARS1 | A... 46 3e-006 TAIR9_protein||AT5G63790.1 | Symbols: ANAC102 | ANAC102 (ARABIDO... 46 4e-006 TAIR9_protein||AT3G04070.1 | Symbols: anac047 | anac047 (Arabido... 45 6e-006 TAIR9_protein||AT3G04070.2 | Symbols: anac047 | anac047 (Arabido... 45 6e-006 TAIR9_protein||AT5G61430.1 | Symbols: ANAC100, ATNAC5 | ANAC100 ... 45 6e-006 TAIR9_protein||AT1G79580.1 | Symbols: SMB, ANAC033 | SMB (SOMBRE... 45 8e-006 TAIR9_protein||AT1G32510.1 | Symbols: anac011 | anac011 (Arabido... 45 8e-006 TAIR9_protein||AT1G79580.2 | Symbols: SMB | SMB (SOMBRERO); tran... 45 8e-006 TAIR9_protein||AT1G79580.3 | Symbols: SMB | SMB (SOMBRERO); tran... 45 8e-006 TAIR9_protein||AT4G36160.1 | Symbols: ANAC076, VND2 | ANAC076 (A... 45 1e-005 >TAIR9_protein||AT4G27410.2 | Symbols: RD26, ANAC072 | RD26 (RESPONSIVE TO DESICCATION 26); transcription activator/ transcription factor | chr4:13707928-13709013 REVERSE Length = 298 Score = 86 bits (211), Expect = 4e-018 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 115 MGVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 MGV E DPL+QLSLPPGFRFYPTDEELLVQYLCRKVAGY F+LQ+ Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYLCRKVAGYHFSLQV 45 >TAIR9_protein||AT4G27410.3 | Symbols: RD26 | RD26 (RESPONSIVE TO DESICCATION 26); transcription activator/ transcription factor | chr4:13707928-13709013 REVERSE Length = 315 Score = 86 bits (211), Expect = 4e-018 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 115 MGVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 MGV E DPL+QLSLPPGFRFYPTDEELLVQYLCRKVAGY F+LQ+ Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYLCRKVAGYHFSLQV 45 >TAIR9_protein||AT1G52890.1 | Symbols: ANAC019 | ANAC019 (Arabidopsis NAC domain containing protein 19); transcription factor | chr1:19697292-19698444 REVERSE Length = 318 Score = 86 bits (210), Expect = 5e-018 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 115 MGVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 MG+ ETDPL+QLSLPPGFRFYPTDEEL+VQYLCRK AGY F+LQ+ Sbjct: 1 MGIQETDPLTQLSLPPGFRFYPTDEELMVQYLCRKAAGYDFSLQL 45 >TAIR9_protein||AT3G15500.1 | Symbols: ATNAC3, ANAC055 | ANAC055 (ARABIDOPSIS NAC DOMAIN CONTAINING PROTEIN 55); transcription factor | chr3:5234731-5235882 FORWARD Length = 318 Score = 79 bits (194), Expect = 4e-016 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 115 MGVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 MG+ E DPL+QLSLPPGFRFYPTDEEL+V+YLCRK AG+ F+LQ+ Sbjct: 1 MGLQELDPLAQLSLPPGFRFYPTDEELMVEYLCRKAAGHDFSLQL 45 >TAIR9_protein||AT5G17260.1 | Symbols: anac086 | anac086 (Arabidopsis NAC domain containing protein 86); transcription factor | chr5:5675323-5677912 REVERSE Length = 477 Score = 50 bits (119), Expect = 2e-007 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = +1 Query: 139 LSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 ++ +SLPPGFRF+PTDEEL+ YL RK+ G + L+I Sbjct: 1 MAPVSLPPGFRFHPTDEELITYYLKRKINGQEIELEI 37 >TAIR9_protein||AT3G03200.1 | Symbols: anac045 | anac045 (Arabidopsis NAC domain containing protein 45); transcription factor | chr3:736141-738527 REVERSE Length = 480 Score = 50 bits (118), Expect = 2e-007 Identities = 20/37 (54%), Positives = 29/37 (78%) Frame = +1 Query: 139 LSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 ++ +SLPPGFRF+PTDEEL+ YL RK+ G + L++ Sbjct: 1 MAPVSLPPGFRFHPTDEELITYYLKRKINGLEIELEV 37 >TAIR9_protein||AT1G54330.1 | Symbols: ANAC020 | ANAC020 (Arabidopsis NAC domain containing protein 20); transcription factor | chr1:20279715-20280889 REVERSE Length = 302 Score = 50 bits (117), Expect = 3e-007 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +1 Query: 139 LSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 ++ +SLPPGFRF+PTDEEL+ YL RKV G L+I Sbjct: 1 MAPMSLPPGFRFHPTDEELVAYYLDRKVNGQAIELEI 37 >TAIR9_protein||AT2G33480.1 | Symbols: ANAC041 | ANAC041 (Arabidopsis NAC domain containing protein 41); transcription factor | chr2:14181275-14182247 FORWARD Length = 269 Score = 49 bits (116), Expect = 4e-007 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 148 LSLPPGFRFYPTDEELLVQYLCRKVAG 228 L LPPGFRF+PTDEEL+VQYL RKV G Sbjct: 13 LRLPPGFRFHPTDEELVVQYLRRKVTG 39 >TAIR9_protein||AT2G33480.2 | Symbols: ANAC041 | ANAC041 (Arabidopsis NAC domain containing protein 41); transcription factor | chr2:14181275-14182247 FORWARD Length = 267 Score = 49 bits (116), Expect = 4e-007 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 148 LSLPPGFRFYPTDEELLVQYLCRKVAG 228 L LPPGFRF+PTDEEL+VQYL RKV G Sbjct: 13 LRLPPGFRFHPTDEELVVQYLRRKVTG 39 >TAIR9_protein||AT1G65910.1 | Symbols: anac028 | anac028 (Arabidopsis NAC domain containing protein 28); transcription factor | chr1:24520933-24524108 REVERSE Length = 632 Score = 49 bits (115), Expect = 5e-007 Identities = 20/37 (54%), Positives = 29/37 (78%) Frame = +1 Query: 139 LSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 ++ +S+PPGFRF+PTDEEL++ YL RK+ G L+I Sbjct: 1 MAPVSMPPGFRFHPTDEELVIYYLKRKINGRTIELEI 37 >TAIR9_protein||AT1G01720.1 | Symbols: ATAF1, ANAC002 | ATAF1; transcription activator/ transcription factor | chr1:268471-269514 FORWARD Length = 290 Score = 49 bits (115), Expect = 5e-007 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +1 Query: 148 LSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 L LPPGFRF+PTDEEL++ YLCRK A + I Sbjct: 5 LQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPI 38 >TAIR9_protein||AT3G18400.1 | Symbols: anac058 | anac058 (Arabidopsis NAC domain containing protein 58); transcription factor | chr3:6318745-6320593 REVERSE Length = 315 Score = 49 bits (115), Expect = 5e-007 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = +1 Query: 151 SLPPGFRFYPTDEELLVQYLCRKVAGYQF 237 +LPPGFRF+PTDEEL+ YLCRKV+ F Sbjct: 4 NLPPGFRFHPTDEELITHYLCRKVSDIGF 32 >TAIR9_protein||AT2G18060.1 | Symbols: VND1, ANAC037 | VND1 (VASCULAR RELATED NAC-DOMAIN PROTEIN 1); transcription factor | chr2:7848399-7850303 REVERSE Length = 366 Score = 48 bits (113), Expect = 9e-007 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = +1 Query: 133 DPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 +P+ S+PPGFRF+PTDEEL+ YL +K+A + +L + Sbjct: 2 EPMESCSVPPGFRFHPTDEELVGYYLRKKIASQKIDLDV 40 >TAIR9_protein||AT5G08790.1 | Symbols: ATAF2, anac081 | ATAF2; transcription activator | chr5:2859113-2860144 REVERSE Length = 284 Score = 48 bits (112), Expect = 1e-006 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = +1 Query: 142 SQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 S+L+LP GFRF+PTDEEL+ YLCRK A Q + + Sbjct: 3 SELNLPAGFRFHPTDEELVKFYLCRKCASEQISAPV 38 >TAIR9_protein||AT1G77450.1 | Symbols: anac032 | anac032 (Arabidopsis NAC domain containing protein 32); transcription factor | chr1:29100029-29100981 FORWARD Length = 254 Score = 47 bits (111), Expect = 2e-006 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = +1 Query: 142 SQLSLPPGFRFYPTDEELLVQYLCRKVA 225 + L PPGFRF+PTDEEL++ YLCRK A Sbjct: 6 ADLQFPPGFRFHPTDEELVLMYLCRKCA 33 >TAIR9_protein||AT4G17980.1 | Symbols: anac071 | anac071 (Arabidopsis NAC domain containing protein 71); transcription factor | chr4:9978850-9980038 REVERSE Length = 263 Score = 47 bits (111), Expect = 2e-006 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = +1 Query: 154 LPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 LPPGFRF+PTDEEL+ YL RK+ G + L++ Sbjct: 6 LPPGFRFHPTDEELIGYYLSRKIEGLEIELEV 37 >TAIR9_protein||AT5G07680.1 | Symbols: ANAC080, ANAC079, ATNAC4 | ANAC080 (ARABIDOPSIS NAC DOMAIN CONTAINING PROTEIN 80); transcription factor | chr5:2436092-2437322 FORWARD Length = 330 Score = 47 bits (111), Expect = 2e-006 Identities = 22/44 (50%), Positives = 28/44 (63%) Frame = +1 Query: 109 EEMGVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFN 240 E GV + Q+ LPPGFRF+PTDEEL+ YL +KV F+ Sbjct: 2 ETFGVFHKEDDEQMDLPPGFRFHPTDEELITHYLHKKVLDLGFS 45 >TAIR9_protein||AT5G46590.1 | Symbols: anac096 | anac096 (Arabidopsis NAC domain containing protein 96); transcription factor | chr5:18905679-18906811 FORWARD Length = 293 Score = 47 bits (111), Expect = 2e-006 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = +1 Query: 154 LPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 LPPGFRF+PTDEEL+ YL RKV G + L++ Sbjct: 6 LPPGFRFHPTDEELIEYYLKRKVEGLEIELEV 37 >TAIR9_protein||AT5G13180.1 | Symbols: ANAC083 | ANAC083 (ARABIDOPSIS NAC DOMAIN CONTAINING PROTEIN 83); transcription factor | chr5:4196643-4197577 FORWARD Length = 253 Score = 47 bits (110), Expect = 2e-006 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +1 Query: 148 LSLPPGFRFYPTDEELLVQYLCRKV 222 L LPPGFRF+PTDEEL+VQYL RKV Sbjct: 12 LRLPPGFRFHPTDEELVVQYLKRKV 36 >TAIR9_protein||AT3G17730.1 | Symbols: anac057 | anac057 (Arabidopsis NAC domain containing protein 57); transcription factor | chr3:6064379-6065813 FORWARD Length = 247 Score = 47 bits (109), Expect = 3e-006 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +1 Query: 139 LSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 ++ + LPPGFRF+PTDEEL+ YL RK+ G + L I Sbjct: 1 MAPVGLPPGFRFHPTDEELVNYYLKRKINGQEIELDI 37 >TAIR9_protein||AT3G15510.1 | Symbols: ATNAC2, ANAC056, NARS1 | ATNAC2 (ARABIDOPSIS NAC DOMAIN CONTAINING PROTEIN 2); transcription factor | chr3:5243696-5245037 FORWARD Length = 365 Score = 46 bits (108), Expect = 3e-006 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +1 Query: 136 PLSQLSLPPGFRFYPTDEELLVQYLCRKVA 225 P Q +LPPGFRF+PTDEEL+V YL RK A Sbjct: 11 PPPQPNLPPGFRFHPTDEELVVHYLKRKAA 40 >TAIR9_protein||AT5G63790.1 | Symbols: ANAC102 | ANAC102 (ARABIDOPSIS NAC DOMAIN CONTAINING PROTEIN 102); transcription factor | chr5:25526887-25528013 REVERSE Length = 313 Score = 46 bits (107), Expect = 4e-006 Identities = 19/36 (52%), Positives = 27/36 (75%) Frame = +1 Query: 142 SQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 ++L+LP GFRF+PTDEEL+ YLCR+ A N+ + Sbjct: 46 AELNLPAGFRFHPTDEELVKFYLCRRCASEPINVPV 81 >TAIR9_protein||AT3G04070.1 | Symbols: anac047 | anac047 (Arabidopsis NAC domain containing protein 47); transcription factor | chr3:1061573-1062976 REVERSE Length = 360 Score = 45 bits (106), Expect = 6e-006 Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +1 Query: 133 DPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 DP S SLPPGFRF+PTDEEL++ YL +KV+ L I Sbjct: 5 DPRS--SLPPGFRFHPTDEELILHYLRKKVSSSPVPLSI 41 >TAIR9_protein||AT3G04070.2 | Symbols: anac047 | anac047 (Arabidopsis NAC domain containing protein 47); transcription factor | chr3:1061573-1062976 REVERSE Length = 344 Score = 45 bits (106), Expect = 6e-006 Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +1 Query: 133 DPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 DP S SLPPGFRF+PTDEEL++ YL +KV+ L I Sbjct: 5 DPRS--SLPPGFRFHPTDEELILHYLRKKVSSSPVPLSI 41 >TAIR9_protein||AT5G61430.1 | Symbols: ANAC100, ATNAC5 | ANAC100 (ARABIDOPSIS NAC DOMAIN CONTAINING PROTEIN 100); transcription factor | chr5:24701328-24702553 REVERSE Length = 337 Score = 45 bits (106), Expect = 6e-006 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +1 Query: 145 QLSLPPGFRFYPTDEELLVQYLCRKVAGYQFN 240 Q+ LPPGFRF+PTDEEL+ YL +KV F+ Sbjct: 13 QMDLPPGFRFHPTDEELITHYLHKKVLDTSFS 44 >TAIR9_protein||AT1G79580.1 | Symbols: SMB, ANAC033 | SMB (SOMBRERO); transcription factor | chr1:29941020-29942925 REVERSE Length = 372 Score = 45 bits (105), Expect = 8e-006 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = +1 Query: 145 QLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 QLS+PPGFRF+PT+EELL YL +KV+ +L + Sbjct: 14 QLSVPPGFRFHPTEEELLYYYLKKKVSYEPIDLDV 48 >TAIR9_protein||AT1G32510.1 | Symbols: anac011 | anac011 (Arabidopsis NAC domain containing protein 11); transcription factor | chr1:11757000-11758118 FORWARD Length = 284 Score = 45 bits (105), Expect = 8e-006 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +1 Query: 154 LPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 LPPGFRFYPTDEEL+ YL R+ G + L+I Sbjct: 6 LPPGFRFYPTDEELVGYYLHRRNEGLEIELEI 37 >TAIR9_protein||AT1G79580.2 | Symbols: SMB | SMB (SOMBRERO); transcription factor | chr1:29941020-29942925 REVERSE Length = 372 Score = 45 bits (105), Expect = 8e-006 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = +1 Query: 145 QLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 QLS+PPGFRF+PT+EELL YL +KV+ +L + Sbjct: 14 QLSVPPGFRFHPTEEELLYYYLKKKVSYEPIDLDV 48 >TAIR9_protein||AT1G79580.3 | Symbols: SMB | SMB (SOMBRERO); transcription factor | chr1:29941020-29942925 REVERSE Length = 372 Score = 45 bits (105), Expect = 8e-006 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = +1 Query: 145 QLSLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 QLS+PPGFRF+PT+EELL YL +KV+ +L + Sbjct: 14 QLSVPPGFRFHPTEEELLYYYLKKKVSYEPIDLDV 48 >TAIR9_protein||AT4G36160.1 | Symbols: ANAC076, VND2 | ANAC076 (ARABIDOPSIS NAC DOMAIN CONTAINING PROTEIN 76); transcription factor | chr4:17110877-17112891 REVERSE Length = 378 Score = 45 bits (104), Expect = 1e-005 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = +1 Query: 151 SLPPGFRFYPTDEELLVQYLCRKVAGYQFNLQI 249 S+PPGFRF+PTDEEL+ YL +KVA + +L + Sbjct: 9 SVPPGFRFHPTDEELVGYYLRKKVASQKIDLDV 41 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,229,259,576 Number of Sequences: 33410 Number of Extensions: 4229259576 Number of Successful Extensions: 229917074 Number of sequences better than 0.0: 0 |