BLASTX 7.6.2 Query= RU24845 /QuerySize=349 (348 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G45428.1 | Symbols: CPuORF24 | CPuORF24 (Conse... 64 1e-011 TAIR9_protein||AT4G19112.1 | Symbols: CPuORF25 | CPuORF25 (Conse... 63 2e-011 >TAIR9_protein||AT5G45428.1 | Symbols: CPuORF24 | CPuORF24 (Conserved peptide upstream open reading frame 24) | chr5:18408137-18408262 FORWARD Length = 42 Score = 64 bits (154), Expect = 1e-011 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -2 Query: 140 MEQVRLLSNCHQYRVFSFQEVLDWRFLVLGDFLLVSFVNCT* 15 MEQ + S C+QYRVFS QE LDWRFLV DFL+ SFVNCT* Sbjct: 1 MEQDYICSGCYQYRVFSLQEALDWRFLVHSDFLIGSFVNCT* 42 >TAIR9_protein||AT4G19112.1 | Symbols: CPuORF25 | CPuORF25 (Conserved peptide upstream open reading frame 25) | chr4:10458368-10458493 REVERSE Length = 42 Score = 63 bits (152), Expect = 2e-011 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 140 MEQVRLLSNCHQYRVFSFQEVLDWRFLVLGDFLLVSFVNCT* 15 MEQV + +C+ YR+FSFQE LDWRFLV DFL+ SFVNCT* Sbjct: 1 MEQVFVWPSCYHYRLFSFQEALDWRFLVRSDFLVGSFVNCT* 42 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,287,271,046 Number of Sequences: 33410 Number of Extensions: 4287271046 Number of Successful Extensions: 235057511 Number of sequences better than 0.0: 0 |