BLASTX 7.6.2 Query= RU25082 /QuerySize=207 (206 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G57840.1 | Symbols: | self-incompatibility pr... 45 6e-006 >TAIR9_protein||AT3G57840.1 | Symbols: | self-incompatibility protein-related | chr3:21422823-21423287 FORWARD Length = 155 Score = 45 bits (106), Expect = 6e-006 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +1 Query: 13 CHECWWSIKSSVNGPCRLNFKTGQYDDCLPWNK 111 C C+WSI+ NGPC LN TG+YD C W+K Sbjct: 124 CRHCFWSIRR--NGPCALNSHTGKYDICYAWDK 154 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,347,376,321 Number of Sequences: 33410 Number of Extensions: 4347376321 Number of Successful Extensions: 240962520 Number of sequences better than 0.0: 0 |