BLASTX 7.6.2 Query= RU25315 /QuerySize=257 (256 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G63840.1 | Symbols: RSW3 | RSW3 (RADIAL SWELLI... 78 1e-015 >TAIR9_protein||AT5G63840.1 | Symbols: RSW3 | RSW3 (RADIAL SWELLING 3); glucosidase/ hydrolase, hydrolyzing O-glycosyl compounds | chr5:25545056-25548922 FORWARD Length = 922 Score = 78 bits (190), Expect = 1e-015 Identities = 35/56 (62%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = +1 Query: 76 CHLSQ-VLSWKRDEFRNCNQTPFCKRARARNPGSSSLTAQDAAISDGELTAKLVPK 240 C SQ LSWK++EFR+C+QTPFCKRAR+R PG+ SL D +I+DG+L AKL+PK Sbjct: 12 CFCSQTALSWKKEEFRSCDQTPFCKRARSRTPGACSLIVGDVSITDGDLVAKLLPK 67 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,375,539,367 Number of Sequences: 33410 Number of Extensions: 4375539367 Number of Successful Extensions: 241311564 Number of sequences better than 0.0: 0 |