BLASTX 7.6.2 Query= RU25412 /QuerySize=483 (482 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G56780.1 | Symbols: | unknown protein | chr5:... 53 7e-008 >TAIR9_protein||AT5G56780.1 | Symbols: | unknown protein | chr5:22964384-22966241 REVERSE Length = 484 Score = 53 bits (126), Expect = 7e-008 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = +2 Query: 2 HRWAPTGTKSEALRTERQQLDKYDYAWNKSFNGARRPDDVLQK 130 +RWAP G+K EA TE L +DYAWNK NG RR D+L+K Sbjct: 150 YRWAPMGSKREAEATEGMLLSTFDYAWNKGSNGERRQLDLLKK 192 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,375,539,367 Number of Sequences: 33410 Number of Extensions: 4375539367 Number of Successful Extensions: 241311564 Number of sequences better than 0.0: 0 |