BLASTX 7.6.2 Query= RU26812 /QuerySize=238 (237 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G13010.1 | Symbols: | oxidoreductase, zinc-bi... 114 1e-026 >TAIR9_protein||AT4G13010.1 | Symbols: | oxidoreductase, zinc-binding dehydrogenase family protein | chr4:7600682-7602567 FORWARD Length = 330 Score = 114 bits (285), Expect = 1e-026 Identities = 47/66 (71%), Positives = 61/66 (92%) Frame = -3 Query: 202 MAAKLMHAVQYDTYGGGPSGLKHVEVPIPTPKKDEVLLKLEAATINPIDWKVQKGLLRPF 23 MA KLMHA+QY++YGGG +GL+HV+VP+PTPK +EV LKLEA ++NP+DWK+QKG++RPF Sbjct: 1 MAGKLMHALQYNSYGGGAAGLEHVQVPVPTPKSNEVCLKLEATSLNPVDWKIQKGMIRPF 60 Query: 22 LPRKFP 5 LPRKFP Sbjct: 61 LPRKFP 66 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,604,738,094 Number of Sequences: 33410 Number of Extensions: 4604738094 Number of Successful Extensions: 252423256 Number of sequences better than 0.0: 0 |