BLASTX 7.6.2 Query= RU26923 /QuerySize=359 (358 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G80920.1 | Symbols: J8 | J8; heat shock protei... 73 3e-014 >TAIR9_protein||AT1G80920.1 | Symbols: J8 | J8; heat shock protein binding / unfolded protein binding | chr1:30403863-30404549 REVERSE Length = 164 Score = 73 bits (177), Expect = 3e-014 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 12 DDSMRGMNDPDYDMWEEWMGWEGAGIRDYTSHINPY 119 D+ + GMNDPD D WEEWMGWEGAG RDY+SH+NPY Sbjct: 127 DEGLNGMNDPDCDTWEEWMGWEGAGTRDYSSHVNPY 162 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,604,738,094 Number of Sequences: 33410 Number of Extensions: 4604738094 Number of Successful Extensions: 252423256 Number of sequences better than 0.0: 0 |