BLASTX 7.6.2 Query= RU27418 /QuerySize=502 (501 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G21060.1 | Symbols: | transducin family prote... 66 9e-012 >TAIR9_protein||AT3G21060.1 | Symbols: | transducin family protein / WD-40 repeat family protein | chr3:7377822-7379942 FORWARD Length = 548 Score = 66 bits (160), Expect = 9e-012 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 404 MNASIIDPLQGDFPEVIEEYLEHGVMKCIAFN 499 MNA IIDPLQGDFPEVIEEYLEHGV+KC+AFN Sbjct: 1 MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFN 32 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,661,322,135 Number of Sequences: 33410 Number of Extensions: 4661322135 Number of Successful Extensions: 252909199 Number of sequences better than 0.0: 0 |