BLASTX 7.6.2 Query= RU27559 /QuerySize=421 (420 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G28900.1 | Symbols: | calcium-binding EF hand... 50 4e-007 TAIR9_protein||AT5G28850.2 | Symbols: | calcium-binding EF hand... 50 4e-007 TAIR9_protein||AT1G54450.1 | Symbols: | calcium-binding EF-hand... 49 8e-007 TAIR9_protein||AT5G44090.1 | Symbols: | calcium-binding EF hand... 48 2e-006 >TAIR9_protein||AT5G28900.1 | Symbols: | calcium-binding EF hand family protein | chr5:10925852-10929892 FORWARD Length = 537 Score = 50 bits (118), Expect = 4e-007 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = +2 Query: 293 IVADAAAFDAELLQLNEVSPLALKANPSFVESLFEQWLSLPD 418 I D A DA+LLQL E+S L + P F + LF+QWLSLP+ Sbjct: 6 IPGDMACLDADLLQLQEMSSFVLNSKPGFTQKLFDQWLSLPE 47 >TAIR9_protein||AT5G28850.2 | Symbols: | calcium-binding EF hand family protein | chr5:10877360-10881278 REVERSE Length = 537 Score = 50 bits (118), Expect = 4e-007 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = +2 Query: 293 IVADAAAFDAELLQLNEVSPLALKANPSFVESLFEQWLSLPD 418 I D A DA+LLQL E+S L + P F + LF+QWLSLP+ Sbjct: 6 IPGDMACLDADLLQLQEMSSFVLNSKPGFTQKLFDQWLSLPE 47 >TAIR9_protein||AT1G54450.1 | Symbols: | calcium-binding EF-hand family protein | chr1:20336570-20339535 REVERSE Length = 536 Score = 49 bits (116), Expect = 8e-007 Identities = 20/39 (51%), Positives = 30/39 (76%) Frame = +2 Query: 302 DAAAFDAELLQLNEVSPLALKANPSFVESLFEQWLSLPD 418 ++ D ELLQL E SP+++K+N FV+ LF+QWL+LP+ Sbjct: 2 ESITLDIELLQLPETSPMSMKSNQDFVKKLFDQWLALPE 40 >TAIR9_protein||AT5G44090.1 | Symbols: | calcium-binding EF hand family protein, putative / protein phosphatase 2A 62 kDa B'' regulatory subunit, putative | chr5:17743264-17747909 REVERSE Length = 539 Score = 48 bits (113), Expect = 2e-006 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +2 Query: 302 DAAAFDAELLQLNEVSPLALKANPSFVESLFEQWLSLPD 418 D D ELLQL +SP++LK NP E LF QWLSLP+ Sbjct: 8 DVQILDPELLQLPGLSPVSLKENPHIAEELFSQWLSLPE 46 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,689,689,278 Number of Sequences: 33410 Number of Extensions: 4689689278 Number of Successful Extensions: 252986479 Number of sequences better than 0.0: 0 |