BLASTX 7.6.2 Query= RU27749 /QuerySize=496 (495 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G71810.1 | Symbols: | ABC1 family protein | c... 56 9e-009 >TAIR9_protein||AT1G71810.1 | Symbols: | ABC1 family protein | chr1:27002602-27007964 REVERSE Length = 693 Score = 56 bits (134), Expect = 9e-009 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 397 FKVRAAELRQILVELGPAYIKIAQAISSRP 486 FKVRAAELR++LVELGPAY+KIAQA+SSRP Sbjct: 116 FKVRAAELRKLLVELGPAYVKIAQAVSSRP 145 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,689,689,278 Number of Sequences: 33410 Number of Extensions: 4689689278 Number of Successful Extensions: 252986479 Number of sequences better than 0.0: 0 |