BLASTX 7.6.2 Query= RU27824 /QuerySize=608 (607 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G44710.1 | Symbols: | FUNCTIONS IN: molecular... 125 3e-029 >TAIR9_protein||AT5G44710.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Ribosomal protein S27/S33, mitochondrial (InterPro:IPR013219); Has 56 Blast hits to 56 proteins in 30 species: Archae - 0; Bacteria - 0; Metazoa - 6; Fungi - 30; Plants - 16; Viruses - 0; Other Eukaryotes - 4 (source: NCBI BLink). | chr5:18041621-18042322 FORWARD Length = 103 Score = 125 bits (312), Expect = 3e-029 Identities = 58/81 (71%), Positives = 72/81 (88%) Frame = +2 Query: 281 MASGSLKSILTAAVNTGVTEARARIFGHVLNPTGLKSAHKILRKKLIGEKVAQWYPHDIR 460 MASGSLKS++++AV GVTEARARIFGH+LNPTG +S HKILRKKLIG+KVA+WYP+DI+ Sbjct: 1 MASGSLKSLISSAVGRGVTEARARIFGHMLNPTGQRSPHKILRKKLIGDKVAEWYPYDIK 60 Query: 461 KDDPLIMEAEEKERTNKLEML 523 +DP ++ EEKER +KLEML Sbjct: 61 NEDPNVLAREEKERISKLEML 81 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,717,856,939 Number of Sequences: 33410 Number of Extensions: 4717856939 Number of Successful Extensions: 253044128 Number of sequences better than 0.0: 0 |