BLASTX 7.6.2 Query= RU28398 /QuerySize=167 (166 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G43540.1 | Symbols: | unknown protein | chr2:... 58 1e-009 >TAIR9_protein||AT2G43540.1 | Symbols: | unknown protein | chr2:18072385-18072894 FORWARD Length = 170 Score = 58 bits (138), Expect = 1e-009 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -3 Query: 164 ILRWVPSPPTRSQVDSALR-AVPRESKTTTTTTLCPAQFKQWAVELFAGAVVGNA 3 I RW+ SPP++SQVDSALR V R + L +FK+WAVE+FA AVVGNA Sbjct: 65 ITRWLSSPPSQSQVDSALRVTVSRVTAADEEEILGQEEFKKWAVEVFAEAVVGNA 119 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,746,010,162 Number of Sequences: 33410 Number of Extensions: 4746010162 Number of Successful Extensions: 253093100 Number of sequences better than 0.0: 0 |