BLASTX 7.6.2 Query= RU28535 /QuerySize=146 (145 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G43010.1 | Symbols: PIF4, SRL2 | PIF4 (phytoch... 85 9e-018 TAIR9_protein||AT2G43010.2 | Symbols: PIF4, SRL2 | PIF4 (phytoch... 85 9e-018 TAIR9_protein||AT3G59060.1 | Symbols: PIL6, PIF5 | PIL6 (PHYTOCH... 85 9e-018 TAIR9_protein||AT3G59060.2 | Symbols: PIL6, PIF5 | PIL6 (PHYTOCH... 85 9e-018 TAIR9_protein||AT3G59060.3 | Symbols: PIL6, PIF5 | PIL6 (PHYTOCH... 85 9e-018 TAIR9_protein||AT3G59060.4 | Symbols: PIL6, PIF5 | PIL6 (PHYTOCH... 85 9e-018 TAIR9_protein||AT4G36930.1 | Symbols: SPT | SPT (SPATULA); DNA b... 72 6e-014 TAIR9_protein||AT1G09530.1 | Symbols: PIF3, POC1, PAP3 | PIF3 (P... 70 2e-013 TAIR9_protein||AT1G09530.2 | Symbols: PIF3, POC1, PAP3 | PIF3 (P... 70 2e-013 TAIR9_protein||AT2G20180.2 | Symbols: PIL5 | PIL5 (PHYTOCHROME I... 69 5e-013 TAIR9_protein||AT2G20180.1 | Symbols: PIL5, PIF1 | PIL5 (PHYTOCH... 69 5e-013 TAIR9_protein||AT4G28811.1 | Symbols: | transcription regulator... 64 2e-011 TAIR9_protein||AT4G28815.1 | Symbols: | transcription regulator... 61 1e-010 TAIR9_protein||AT4G28800.1 | Symbols: | transcription factor | ... 61 1e-010 TAIR9_protein||AT4G28790.2 | Symbols: | basic helix-loop-helix ... 60 2e-010 TAIR9_protein||AT4G28790.1 | Symbols: | basic helix-loop-helix ... 60 2e-010 TAIR9_protein||AT5G67110.1 | Symbols: ALC | ALC (ALCATRAZ); DNA ... 60 3e-010 TAIR9_protein||AT5G67110.2 | Symbols: ALC | ALC (ALCATRAZ); DNA ... 56 5e-009 TAIR9_protein||AT5G61270.1 | Symbols: PIF7 | PIF7 (PHYTOCHROME-I... 55 1e-008 TAIR9_protein||AT5G61270.2 | Symbols: PIF7 | PIF7 (PHYTOCHROME-I... 55 1e-008 TAIR9_protein||AT2G24260.1 | Symbols: | basic helix-loop-helix ... 53 4e-008 TAIR9_protein||AT5G58010.1 | Symbols: | basic helix-loop-helix ... 52 7e-008 TAIR9_protein||AT4G30980.1 | Symbols: | basic helix-loop-helix ... 52 9e-008 TAIR9_protein||AT4G02590.1 | Symbols: UNE12 | UNE12 (unfertilize... 48 1e-006 TAIR9_protein||AT4G02590.2 | Symbols: UNE12 | UNE12 (unfertilize... 48 1e-006 TAIR9_protein||AT4G02590.3 | Symbols: UNE12 | UNE12 (unfertilize... 48 1e-006 TAIR9_protein||AT1G03040.1 | Symbols: | basic helix-loop-helix ... 47 2e-006 >TAIR9_protein||AT2G43010.1 | Symbols: PIF4, SRL2 | PIF4 (phytochrome interacting factor 4); DNA binding / protein binding / transcription factor | chr2:17887003-17888823 FORWARD Length = 431 Score = 85 bits (208), Expect = 9e-018 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -2 Query: 144 NKPAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 NK QRSGS+RR+RAAEVHNLSERRRRDRINE+MKALQELIPH +KTD Sbjct: 244 NKSNQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTD 291 >TAIR9_protein||AT2G43010.2 | Symbols: PIF4, SRL2 | PIF4 (phytochrome interacting factor 4); DNA binding / protein binding / transcription factor | chr2:17887003-17888823 FORWARD Length = 429 Score = 85 bits (208), Expect = 9e-018 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -2 Query: 144 NKPAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 NK QRSGS+RR+RAAEVHNLSERRRRDRINE+MKALQELIPH +KTD Sbjct: 244 NKSNQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTD 291 >TAIR9_protein||AT3G59060.1 | Symbols: PIL6, PIF5 | PIL6 (PHYTOCHROME INTERACTING FACTOR 3-LIKE 6); DNA binding / transcription factor | chr3:21828189-21829895 REVERSE Length = 443 Score = 85 bits (208), Expect = 9e-018 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -2 Query: 144 NKPAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 NK +QRSGS+RR+RAAEVHNLSERRRRDRINE+MKALQELIPH ++TD Sbjct: 243 NKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD 290 >TAIR9_protein||AT3G59060.2 | Symbols: PIL6, PIF5 | PIL6 (PHYTOCHROME INTERACTING FACTOR 3-LIKE 6); DNA binding / transcription factor | chr3:21828189-21829895 REVERSE Length = 445 Score = 85 bits (208), Expect = 9e-018 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -2 Query: 144 NKPAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 NK +QRSGS+RR+RAAEVHNLSERRRRDRINE+MKALQELIPH ++TD Sbjct: 243 NKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD 290 >TAIR9_protein||AT3G59060.3 | Symbols: PIL6, PIF5 | PIL6 (PHYTOCHROME INTERACTING FACTOR 3-LIKE 6); DNA binding / transcription factor | chr3:21828189-21829895 REVERSE Length = 445 Score = 85 bits (208), Expect = 9e-018 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -2 Query: 144 NKPAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 NK +QRSGS+RR+RAAEVHNLSERRRRDRINE+MKALQELIPH ++TD Sbjct: 243 NKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD 290 >TAIR9_protein||AT3G59060.4 | Symbols: PIL6, PIF5 | PIL6 (PHYTOCHROME INTERACTING FACTOR 3-LIKE 6); DNA binding / transcription factor | chr3:21828189-21829895 REVERSE Length = 445 Score = 85 bits (208), Expect = 9e-018 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -2 Query: 144 NKPAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 NK +QRSGS+RR+RAAEVHNLSERRRRDRINE+MKALQELIPH ++TD Sbjct: 243 NKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD 290 >TAIR9_protein||AT4G36930.1 | Symbols: SPT | SPT (SPATULA); DNA binding / transcription factor | chr4:17414167-17415945 FORWARD Length = 374 Score = 72 bits (175), Expect = 6e-014 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 138 PAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 P+ RS SS+R RAAEVHNLSE+RRR RINEKMKALQ LIP+SNKTD Sbjct: 187 PSSRS-SSKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTD 231 >TAIR9_protein||AT1G09530.1 | Symbols: PIF3, POC1, PAP3 | PIF3 (PHYTOCHROME INTERACTING FACTOR 3); DNA binding / protein binding / transcription factor/ transcription regulator | chr1:3077216-3079367 FORWARD Length = 525 Score = 70 bits (170), Expect = 2e-013 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -2 Query: 138 PAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 P++ S+R+R+AEVHNLSERRRRDRINEKM+ALQELIP+ NK D Sbjct: 332 PSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVD 377 >TAIR9_protein||AT1G09530.2 | Symbols: PIF3, POC1, PAP3 | PIF3 (PHYTOCHROME INTERACTING FACTOR 3); DNA binding / protein binding / transcription factor/ transcription regulator | chr1:3077216-3079367 FORWARD Length = 525 Score = 70 bits (170), Expect = 2e-013 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -2 Query: 138 PAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 P++ S+R+R+AEVHNLSERRRRDRINEKM+ALQELIP+ NK D Sbjct: 332 PSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVD 377 >TAIR9_protein||AT2G20180.2 | Symbols: PIL5 | PIL5 (PHYTOCHROME INTERACTING FACTOR 3-LIKE 5); DNA binding / phytochrome binding / transcription factor | chr2:8704525-8706538 REVERSE Length = 479 Score = 69 bits (167), Expect = 5e-013 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -2 Query: 120 SSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 S++R+RAAEVHNLSER+RRDRINE+MKALQELIP NK+D Sbjct: 279 STKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKSD 318 >TAIR9_protein||AT2G20180.1 | Symbols: PIL5, PIF1 | PIL5 (PHYTOCHROME INTERACTING FACTOR 3-LIKE 5); DNA binding / phytochrome binding / transcription factor | chr2:8704525-8706237 REVERSE Length = 408 Score = 69 bits (167), Expect = 5e-013 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -2 Query: 120 SSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 S++R+RAAEVHNLSER+RRDRINE+MKALQELIP NK+D Sbjct: 208 STKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKSD 247 >TAIR9_protein||AT4G28811.1 | Symbols: | transcription regulator | chr4:14225335-14227840 FORWARD Length = 545 Score = 64 bits (154), Expect = 2e-011 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -2 Query: 135 AQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 A S S +R+RAA++HNLSERRRR+RINE+MK LQEL+P KTD Sbjct: 347 AHGSTSRKRSRAADMHNLSERRRRERINERMKTLQELLPRCRKTD 391 >TAIR9_protein||AT4G28815.1 | Symbols: | transcription regulator | chr4:14228719-14230288 FORWARD Length = 308 Score = 61 bits (147), Expect = 1e-010 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = -2 Query: 135 AQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKT 4 A+ S S +R+RAAE+HNL+ERRRR++INE+MK LQ+LIP NK+ Sbjct: 140 ARGSTSRKRSRAAEMHNLAERRRREKINERMKTLQQLIPRCNKS 183 >TAIR9_protein||AT4G28800.1 | Symbols: | transcription factor | chr4:14221970-14224075 FORWARD Length = 446 Score = 61 bits (146), Expect = 1e-010 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -2 Query: 135 AQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKT 4 A+ S S +R+R AE+HNL+ERRRR++INEKMK LQ+LIP NK+ Sbjct: 245 ARGSTSRKRSRTAEMHNLAERRRREKINEKMKTLQQLIPRCNKS 288 >TAIR9_protein||AT4G28790.2 | Symbols: | basic helix-loop-helix (bHLH) family protein | chr4:14218329-14219887 FORWARD Length = 341 Score = 60 bits (145), Expect = 2e-010 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -2 Query: 135 AQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 A+ S SS+R+RAA +H LSERRRR +INE MKALQEL+P KTD Sbjct: 267 ARDSTSSKRSRAAIMHKLSERRRRQKINEMMKALQELLPRCTKTD 311 >TAIR9_protein||AT4G28790.1 | Symbols: | basic helix-loop-helix (bHLH) family protein | chr4:14218329-14220173 FORWARD Length = 414 Score = 60 bits (145), Expect = 2e-010 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -2 Query: 135 AQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 A+ S SS+R+RAA +H LSERRRR +INE MKALQEL+P KTD Sbjct: 267 ARDSTSSKRSRAAIMHKLSERRRRQKINEMMKALQELLPRCTKTD 311 >TAIR9_protein||AT5G67110.1 | Symbols: ALC | ALC (ALCATRAZ); DNA binding / transcription factor | chr5:26785332-26786338 REVERSE Length = 211 Score = 60 bits (143), Expect = 3e-010 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -2 Query: 135 AQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 A++ S +R A+ HNLSE++RR +INEKMKALQ+LIP+SNKTD Sbjct: 83 AKQRNSLKRNIDAQFHNLSEKKRRSKINEKMKALQKLIPNSNKTD 127 >TAIR9_protein||AT5G67110.2 | Symbols: ALC | ALC (ALCATRAZ); DNA binding / transcription factor | chr5:26785684-26786338 REVERSE Length = 151 Score = 56 bits (133), Expect = 5e-009 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -2 Query: 135 AQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 A++ S +R A+ HNLSE++RR +INEKMKALQ+LIP+SNK + Sbjct: 83 AKQRNSLKRNIDAQFHNLSEKKRRSKINEKMKALQKLIPNSNKVN 127 >TAIR9_protein||AT5G61270.1 | Symbols: PIF7 | PIF7 (PHYTOCHROME-INTERACTING FACTOR7); DNA binding / double-stranded DNA binding / transcription factor | chr5:24638873-24640439 REVERSE Length = 367 Score = 55 bits (130), Expect = 1e-008 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -2 Query: 120 SSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 + RR RAA +HN SERRRRDRIN++M+ LQ+L+P ++K D Sbjct: 161 NGRRGRAAAIHNESERRRRDRINQRMRTLQKLLPTASKAD 200 >TAIR9_protein||AT5G61270.2 | Symbols: PIF7 | PIF7 (PHYTOCHROME-INTERACTING FACTOR7); DNA binding / double-stranded DNA binding / transcription factor | chr5:24638873-24640031 REVERSE Length = 279 Score = 55 bits (130), Expect = 1e-008 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -2 Query: 120 SSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 + RR RAA +HN SERRRRDRIN++M+ LQ+L+P ++K D Sbjct: 73 NGRRGRAAAIHNESERRRRDRINQRMRTLQKLLPTASKAD 112 >TAIR9_protein||AT2G24260.1 | Symbols: | basic helix-loop-helix (bHLH) family protein | chr2:10319646-10322177 REVERSE Length = 351 Score = 53 bits (125), Expect = 4e-008 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = -2 Query: 117 SRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 +RR +A + H+++ER RR+RI E+MKALQEL+P+ NKTD Sbjct: 140 ARRGQATDPHSIAERLRRERIAERMKALQELVPNGNKTD 178 >TAIR9_protein||AT5G58010.1 | Symbols: | basic helix-loop-helix (bHLH) family protein | chr5:23483670-23484889 REVERSE Length = 298 Score = 52 bits (123), Expect = 7e-008 Identities = 22/39 (56%), Positives = 34/39 (87%) Frame = -2 Query: 117 SRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 +RR +A + H+++ER RR+RI E+MK+LQEL+P++NKTD Sbjct: 101 ARRGQATDPHSIAERLRRERIAERMKSLQELVPNTNKTD 139 >TAIR9_protein||AT4G30980.1 | Symbols: | basic helix-loop-helix (bHLH) family protein | chr4:15079489-15081606 REVERSE Length = 311 Score = 52 bits (122), Expect = 9e-008 Identities = 22/39 (56%), Positives = 33/39 (84%) Frame = -2 Query: 117 SRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 +RR +A + H+++ER RR+RI E+MK+LQEL+P+ NKTD Sbjct: 132 ARRGQATDPHSIAERLRRERIAERMKSLQELVPNGNKTD 170 >TAIR9_protein||AT4G02590.1 | Symbols: UNE12 | UNE12 (unfertilized embryo sac 12); DNA binding / transcription factor | chr4:1137968-1140306 REVERSE Length = 311 Score = 48 bits (113), Expect = 1e-006 Identities = 21/39 (53%), Positives = 32/39 (82%) Frame = -2 Query: 117 SRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 +RR +A + H+++ER RR+RI E+++ALQEL+P NKTD Sbjct: 148 ARRGQATDPHSIAERLRRERIAERIRALQELVPTVNKTD 186 >TAIR9_protein||AT4G02590.2 | Symbols: UNE12 | UNE12 (unfertilized embryo sac 12); DNA binding / transcription factor | chr4:1137968-1140306 REVERSE Length = 311 Score = 48 bits (113), Expect = 1e-006 Identities = 21/39 (53%), Positives = 32/39 (82%) Frame = -2 Query: 117 SRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 +RR +A + H+++ER RR+RI E+++ALQEL+P NKTD Sbjct: 148 ARRGQATDPHSIAERLRRERIAERIRALQELVPTVNKTD 186 >TAIR9_protein||AT4G02590.3 | Symbols: UNE12 | UNE12 (unfertilized embryo sac 12); DNA binding / transcription factor | chr4:1137968-1140117 REVERSE Length = 248 Score = 48 bits (113), Expect = 1e-006 Identities = 21/39 (53%), Positives = 32/39 (82%) Frame = -2 Query: 117 SRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 +RR +A + H+++ER RR+RI E+++ALQEL+P NKTD Sbjct: 85 ARRGQATDPHSIAERLRRERIAERIRALQELVPTVNKTD 123 >TAIR9_protein||AT1G03040.1 | Symbols: | basic helix-loop-helix (bHLH) family protein | chr1:704279-706457 REVERSE Length = 303 Score = 47 bits (110), Expect = 2e-006 Identities = 20/39 (51%), Positives = 32/39 (82%) Frame = -2 Query: 117 SRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD 1 +RR +A + H+++ER RR+RI E++++LQEL+P NKTD Sbjct: 146 ARRGQATDPHSIAERLRRERIAERIRSLQELVPTVNKTD 184 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,746,010,162 Number of Sequences: 33410 Number of Extensions: 4746010162 Number of Successful Extensions: 253093100 Number of sequences better than 0.0: 0 |