BLASTX 7.6.2 Query= RU29262 /QuerySize=155 (154 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G42170.1 | Symbols: | DNA binding | chr3:1432... 83 3e-017 >TAIR9_protein||AT3G42170.1 | Symbols: | DNA binding | chr3:14321838-14323928 FORWARD Length = 697 Score = 83 bits (204), Expect = 3e-017 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = +2 Query: 2 TIENVSPGCRRACCKQCKQSFAYSTGSKVAGTSHLKRHIAKGTCPALL 145 TIE V P CRRA CK C QSFAYS G+KVAGTSHLKRHI KGTCPAL+ Sbjct: 75 TIEAVEPNCRRAFCKGCNQSFAYSNGNKVAGTSHLKRHIFKGTCPALI 122 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,805,693,934 Number of Sequences: 33410 Number of Extensions: 4805693934 Number of Successful Extensions: 258754419 Number of sequences better than 0.0: 0 |