BLASTX 7.6.2 Query= RU30122 /QuerySize=175 (174 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G21720.1 | Symbols: | unknown protein | chr4:... 82 8e-017 >TAIR9_protein||AT4G21720.1 | Symbols: | unknown protein | chr4:11542561-11544274 FORWARD Length = 140 Score = 82 bits (200), Expect = 8e-017 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +2 Query: 29 MIPHQWGPPCNHECTHKYAALMQIPWRVFCKKGCDTDGETWEEC 160 MIP QW PPC +CT+KY+A Q+PWRVFCKKGCD D ++WE+C Sbjct: 1 MIPQQWTPPCGSKCTNKYSAFTQLPWRVFCKKGCDADSDSWEDC 44 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,863,818,246 Number of Sequences: 33410 Number of Extensions: 4863818246 Number of Successful Extensions: 259182576 Number of sequences better than 0.0: 0 |