BLASTX 7.6.2 Query= RU30348 /QuerySize=128 (127 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G12680.1 | Symbols: HUA1 | HUA1 (ENHANCER OF A... 69 4e-013 >TAIR9_protein||AT3G12680.1 | Symbols: HUA1 | HUA1 (ENHANCER OF AG-4 1); RNA binding | chr3:4025276-4028999 REVERSE Length = 525 Score = 69 bits (168), Expect = 4e-013 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +2 Query: 5 QQENVKLTLAGLPRREGAVICVCCPKTGTCKYGATCRFDHP 127 QQ NVKL+LAG PRREGA+ C KTGTCKYGATC+FDHP Sbjct: 459 QQPNVKLSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHP 499 Score = 47 bits (111), Expect = 2e-006 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +2 Query: 35 GLPRREGAVICVCCPKTGTCKYGATCRFDHP 127 GLP R G V C KTG+CKYGATCR++HP Sbjct: 336 GLPVRSGEVDCPFYLKTGSCKYGATCRYNHP 366 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,893,016,647 Number of Sequences: 33410 Number of Extensions: 4893016647 Number of Successful Extensions: 259244453 Number of sequences better than 0.0: 0 |