BLASTX 7.6.2 Query= RU31985 /QuerySize=249 (248 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G14470.1 | Symbols: | disease resistance prot... 55 6e-009 >TAIR9_protein||AT3G14470.1 | Symbols: | disease resistance protein (NBS-LRR class), putative | chr3:4857940-4861104 FORWARD Length = 1055 Score = 55 bits (132), Expect = 6e-009 Identities = 24/51 (47%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +3 Query: 96 IPSTSLVDESSIIARGSDKEKIIQMVLSEQGEGGGNVSVIPIVGMGGIGKT 248 +P+TSLVDES + R DK++I++ ++ E G+ G ++V+ IVG+GG+GKT Sbjct: 161 LPTTSLVDESEVFGRDDDKDEIMRFLIPENGKDNG-ITVVAIVGIGGVGKT 210 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,951,173,418 Number of Sequences: 33410 Number of Extensions: 4951173418 Number of Successful Extensions: 259336112 Number of sequences better than 0.0: 0 |