BLASTX 7.6.2 Query= RU32011 /QuerySize=247 (246 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G56940.1 | Symbols: CRD1, CHL27, ACSF | CRD1 (... 72 8e-014 >TAIR9_protein||AT3G56940.1 | Symbols: CRD1, CHL27, ACSF | CRD1 (COPPER RESPONSE DEFECT 1); DNA binding / magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase | chr3:21076594-21078269 FORWARD Length = 410 Score = 72 bits (174), Expect = 8e-014 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 125 IKETLLAPRFYTTDFDEMETLFNTEINNNLNQVEFEALLQE 3 I+E+LL PRFYTTDF+EME LFNTEIN NLN+ EFEALLQE Sbjct: 61 IQESLLTPRFYTTDFEEMEQLFNTEINKNLNEAEFEALLQE 101 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,007,806,328 Number of Sequences: 33410 Number of Extensions: 5007806328 Number of Successful Extensions: 264383962 Number of sequences better than 0.0: 0 |