BLASTX 7.6.2 Query= RU32459 /QuerySize=252 (251 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G41310.1 | Symbols: | kinesin motor protein-r... 45 6e-006 >TAIR9_protein||AT5G41310.1 | Symbols: | kinesin motor protein-related | chr5:16516634-16522392 REVERSE Length = 962 Score = 45 bits (106), Expect = 6e-006 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Frame = -2 Query: 166 KSNGTSRKDPKLVERSGSTIDGNE--ILALVE*LNYIIPYLRLPTDASEEEIRACLI 2 +S+G+S S +ID N+ +LVE LN +PYL LP +ASEEE+RACL+ Sbjct: 17 RSDGSSSIQSSNGSESRESIDDNKQGHQSLVEWLNETLPYLNLPWEASEEELRACLV 73 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,007,806,328 Number of Sequences: 33410 Number of Extensions: 5007806328 Number of Successful Extensions: 264383962 Number of sequences better than 0.0: 0 |