BLASTX 7.6.2 Query= RU32875 /QuerySize=214 (213 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G19330.1 | Symbols: | armadillo/beta-catenin ... 140 2e-034 TAIR9_protein||AT5G13060.1 | Symbols: ABAP1 | ABAP1 (ARMADILLO B... 115 6e-027 TAIR9_protein||AT5G19330.2 | Symbols: | armadillo/beta-catenin ... 74 2e-014 >TAIR9_protein||AT5G19330.1 | Symbols: | armadillo/beta-catenin repeat family protein / BTB/POZ domain-containing protein | chr5:6508095-6512701 REVERSE Length = 711 Score = 140 bits (352), Expect = 2e-034 Identities = 67/70 (95%), Positives = 68/70 (97%) Frame = +2 Query: 2 VYLGEQYVNNPTLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNI 181 VYLGEQYVNN TLSDVTFLVEGR FYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNI Sbjct: 528 VYLGEQYVNNATLSDVTFLVEGRTFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNI 587 Query: 182 RWEVFELMMR 211 +WEVFELMMR Sbjct: 588 KWEVFELMMR 597 >TAIR9_protein||AT5G13060.1 | Symbols: ABAP1 | ABAP1 (ARMADILLO BTB ARABIDOPSIS PROTEIN 1); protein binding | chr5:4142958-4146952 FORWARD Length = 738 Score = 115 bits (287), Expect = 6e-027 Identities = 50/70 (71%), Positives = 67/70 (95%) Frame = +2 Query: 2 VYLGEQYVNNPTLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNI 181 V+LGE++VNNPT+SDVTFL++G++FYAH+I L+ASSD FRAMFDG Y+E++A+++EIPNI Sbjct: 555 VFLGEKFVNNPTMSDVTFLIDGKQFYAHKIGLVASSDIFRAMFDGLYKERNAQNVEIPNI 614 Query: 182 RWEVFELMMR 211 RWEVFELMM+ Sbjct: 615 RWEVFELMMK 624 >TAIR9_protein||AT5G19330.2 | Symbols: | armadillo/beta-catenin repeat family protein / BTB/POZ domain-containing protein | chr5:6508300-6512701 REVERSE Length = 637 Score = 74 bits (179), Expect = 2e-014 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +2 Query: 110 DAFRAMFDGGYREKDARDIEIPNIRWEVFELMMR 211 DAFRAMFDGGYREKDARDIEIPNI+WEVFELMMR Sbjct: 516 DAFRAMFDGGYREKDARDIEIPNIKWEVFELMMR 549 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,065,972,084 Number of Sequences: 33410 Number of Extensions: 5065972084 Number of Successful Extensions: 269508837 Number of sequences better than 0.0: 0 |