BLASTX 7.6.2 Query= RU33297 /QuerySize=133 (132 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G00990.1 | Symbols: | transcription factor ju... 76 3e-015 TAIR9_protein||AT1G09060.1 | Symbols: | transcription factor ju... 69 7e-013 TAIR9_protein||AT1G09060.2 | Symbols: | transcription factor ju... 69 7e-013 TAIR9_protein||AT1G09060.3 | Symbols: | transcription factor ju... 69 7e-013 TAIR9_protein||AT1G11950.1 | Symbols: | transcription factor | ... 67 2e-012 TAIR9_protein||AT1G62310.1 | Symbols: | transcription factor ju... 66 5e-012 TAIR9_protein||AT4G21430.1 | Symbols: B160 | B160; protein bindi... 62 9e-011 TAIR9_protein||AT3G07610.1 | Symbols: IBM1 | IBM1 (increase in b... 60 3e-010 >TAIR9_protein||AT4G00990.1 | Symbols: | transcription factor jumonji (jmjC) domain-containing protein | chr4:427035-431535 FORWARD Length = 841 Score = 76 bits (186), Expect = 3e-015 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 126 KKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQS 22 KKQLKEEFD+EPWTFEQHLGEAVFIPAGCPHQV++ Sbjct: 736 KKQLKEEFDIEPWTFEQHLGEAVFIPAGCPHQVRN 770 >TAIR9_protein||AT1G09060.1 | Symbols: | transcription factor jumonji (jmjC) domain-containing protein | chr1:2921235-2925212 REVERSE Length = 931 Score = 69 bits (166), Expect = 7e-013 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 129 HKKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSLIMN 10 HK+QL++EF VEPWTFEQH GEA+FIPAGCP Q+ +L N Sbjct: 796 HKRQLRDEFGVEPWTFEQHRGEAIFIPAGCPFQITNLQSN 835 >TAIR9_protein||AT1G09060.2 | Symbols: | transcription factor jumonji (jmjC) domain-containing protein | chr1:2921235-2925212 REVERSE Length = 931 Score = 69 bits (166), Expect = 7e-013 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 129 HKKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSLIMN 10 HK+QL++EF VEPWTFEQH GEA+FIPAGCP Q+ +L N Sbjct: 796 HKRQLRDEFGVEPWTFEQHRGEAIFIPAGCPFQITNLQSN 835 >TAIR9_protein||AT1G09060.3 | Symbols: | transcription factor jumonji (jmjC) domain-containing protein | chr1:2921235-2925254 REVERSE Length = 945 Score = 69 bits (166), Expect = 7e-013 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 129 HKKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSLIMN 10 HK+QL++EF VEPWTFEQH GEA+FIPAGCP Q+ +L N Sbjct: 810 HKRQLRDEFGVEPWTFEQHRGEAIFIPAGCPFQITNLQSN 849 >TAIR9_protein||AT1G11950.1 | Symbols: | transcription factor | chr1:4034747-4038310 REVERSE Length = 876 Score = 67 bits (162), Expect = 2e-012 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 129 HKKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSL 19 HK++LK EF +EPWTF Q LGEAVFIPAGCPHQV++L Sbjct: 774 HKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVRNL 810 >TAIR9_protein||AT1G62310.1 | Symbols: | transcription factor jumonji (jmjC) domain-containing protein | chr1:23036039-23039301 REVERSE Length = 884 Score = 66 bits (159), Expect = 5e-012 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 129 HKKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSL 19 HK++LK E+ +EPWTF Q LGEAVFIPAGCPHQV++L Sbjct: 800 HKRKLKAEYGIEPWTFVQKLGEAVFIPAGCPHQVRNL 836 >TAIR9_protein||AT4G21430.1 | Symbols: B160 | B160; protein binding / transcription factor/ zinc ion binding | chr4:11407835-11412159 REVERSE Length = 928 Score = 62 bits (148), Expect = 9e-011 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = -1 Query: 129 HKKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQ 25 HK +LKEEFDVEPW+F+Q +GEAV +PAGCP+Q++ Sbjct: 818 HKARLKEEFDVEPWSFDQCVGEAVILPAGCPYQIR 852 >TAIR9_protein||AT3G07610.1 | Symbols: IBM1 | IBM1 (increase in bonsai methylation 1); histone demethylase(H3-K9 specific) / transcription factor | chr3:2426148-2432876 FORWARD Length = 1028 Score = 60 bits (143), Expect = 3e-010 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 129 HKKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSL 19 H +LKEE+ +EPWTF Q LG+AV IP GCPHQV++L Sbjct: 797 HIMKLKEEYGIEPWTFNQKLGDAVLIPVGCPHQVRNL 833 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,065,972,084 Number of Sequences: 33410 Number of Extensions: 5065972084 Number of Successful Extensions: 269508837 Number of sequences better than 0.0: 0 |