BLASTX 7.6.2 Query= RU34301 /QuerySize=161 (160 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G67030.1 | Symbols: ABA1, LOS6, NPQ2, ATABA1, ... 52 9e-008 >TAIR9_protein||AT5G67030.1 | Symbols: ABA1, LOS6, NPQ2, ATABA1, ZEP, IBS3, ATZEP | ABA1 (ABA DEFICIENT 1); zeaxanthin epoxidase | chr5:26753745-26757090 REVERSE Length = 668 Score = 52 bits (122), Expect = 9e-008 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%) Frame = +1 Query: 13 PCIIGNTSNGD--SSVISVPLPQVSENHASITYKDGGFYLSDLRSKYGTWL 159 PCI+G+ + D I +P QVS+ HA + YKDG F+L DLRS++GT++ Sbjct: 557 PCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAFFLMDLRSEHGTYV 607 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,182,075,661 Number of Sequences: 33410 Number of Extensions: 5182075661 Number of Successful Extensions: 280418137 Number of sequences better than 0.0: 0 |