BLASTX 7.6.2 Query= RU34671 /QuerySize=239 (238 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G55960.1 | Symbols: | NLI interacting factor ... 52 6e-008 >TAIR9_protein||AT3G55960.1 | Symbols: | NLI interacting factor (NIF) family protein | chr3:20760797-20762892 REVERSE Length = 306 Score = 52 bits (123), Expect = 6e-008 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = +3 Query: 42 MASVGQAAEVYEPKPLQVWRALMNWLGFFFQIIVQILR 155 MA + QA VY P+ QVW+ L+NWL FF+QI +QILR Sbjct: 1 MAELTQADVVYSPRSFQVWKTLVNWLAFFYQIFLQILR 38 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,210,819,953 Number of Sequences: 33410 Number of Extensions: 5210819953 Number of Successful Extensions: 280722841 Number of sequences better than 0.0: 0 |