BLASTX 7.6.2 Query= RU34917 /QuerySize=245 (244 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G40730.1 | Symbols: | HEAT repeat-containing ... 72 8e-014 >TAIR9_protein||AT2G40730.1 | Symbols: | HEAT repeat-containing protein | chr2:16990083-16996072 REVERSE Length = 799 Score = 72 bits (174), Expect = 8e-014 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 130 MLKFLNRVVGGSGSGPKDLPYNIGEPYPSAWGSWTHFR 243 M KFL VV GSG+G KDLPYNIG+PYPSAWGSW+HFR Sbjct: 1 MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFR 38 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,239,339,544 Number of Sequences: 33410 Number of Extensions: 5239339544 Number of Successful Extensions: 280848791 Number of sequences better than 0.0: 0 |