BLASTX 7.6.2 Query= RU34969 /QuerySize=150 (149 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G39760.1 | Symbols: ATBPM3, BPM3 | BPM3; prote... 75 6e-015 TAIR9_protein||AT2G39760.2 | Symbols: ATBPM3, BPM3 | BPM3; prote... 75 6e-015 TAIR9_protein||AT5G19000.1 | Symbols: ATBPM1 | ATBPM1 (BTB-POZ a... 64 2e-011 TAIR9_protein||AT3G06190.1 | Symbols: ATBPM2, BPM2 | BPM2 (BTB-P... 55 1e-008 TAIR9_protein||AT3G06190.2 | Symbols: ATBPM2, BPM2 | BPM2 (BTB-P... 55 1e-008 TAIR9_protein||AT5G21010.1 | Symbols: ATBPM5 | ATBPM5 (BTB-POZ a... 53 3e-008 TAIR9_protein||AT3G03740.1 | Symbols: ATBPM4 | ATBPM4 (BTB-POZ a... 53 4e-008 TAIR9_protein||AT3G43700.1 | Symbols: ATBPM6 | ATBPM6 (BTB-POZ a... 49 4e-007 >TAIR9_protein||AT2G39760.1 | Symbols: ATBPM3, BPM3 | BPM3; protein binding | chr2:16583213-16585983 FORWARD Length = 409 Score = 75 bits (184), Expect = 6e-015 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 149 ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKA 3 I +P S+MG+GLK LDS GCD+ FQVGDE +KAHKLILAARSPVF+A Sbjct: 173 IVLPLSNMGQGLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRA 221 >TAIR9_protein||AT2G39760.2 | Symbols: ATBPM3, BPM3 | BPM3; protein binding | chr2:16583213-16584815 FORWARD Length = 344 Score = 75 bits (184), Expect = 6e-015 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 149 ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKA 3 I +P S+MG+GLK LDS GCD+ FQVGDE +KAHKLILAARSPVF+A Sbjct: 173 IVLPLSNMGQGLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRA 221 >TAIR9_protein||AT5G19000.1 | Symbols: ATBPM1 | ATBPM1 (BTB-POZ and MATH domain 1); protein binding | chr5:6342563-6344641 FORWARD Length = 408 Score = 64 bits (154), Expect = 2e-011 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = -1 Query: 149 ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKA 3 I VP S++G+ L L+SG GCDVVFQV E F AHKL+LA RSPVF A Sbjct: 182 IPVPVSNLGQQLGNLLESGKGCDVVFQVDGETFNAHKLVLATRSPVFNA 230 >TAIR9_protein||AT3G06190.1 | Symbols: ATBPM2, BPM2 | BPM2 (BTB-POZ AND MATH DOMAIN 2); protein binding | chr3:1874577-1876575 REVERSE Length = 407 Score = 55 bits (130), Expect = 1e-008 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -1 Query: 149 ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKA 3 I VP S +G+ L+SG G DV F+V E F AHKL+LAARS VF+A Sbjct: 181 IPVPVSGLGQQFGKLLESGKGADVTFEVDGETFPAHKLVLAARSAVFRA 229 >TAIR9_protein||AT3G06190.2 | Symbols: ATBPM2, BPM2 | BPM2 (BTB-POZ AND MATH DOMAIN 2); protein binding | chr3:1874577-1876575 REVERSE Length = 296 Score = 55 bits (130), Expect = 1e-008 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -1 Query: 149 ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKA 3 I VP S +G+ L+SG G DV F+V E F AHKL+LAARS VF+A Sbjct: 181 IPVPVSGLGQQFGKLLESGKGADVTFEVDGETFPAHKLVLAARSAVFRA 229 >TAIR9_protein||AT5G21010.1 | Symbols: ATBPM5 | ATBPM5 (BTB-POZ and MATH domain 5); protein binding | chr5:7136062-7138374 FORWARD Length = 411 Score = 53 bits (126), Expect = 3e-008 Identities = 24/49 (48%), Positives = 32/49 (65%) Frame = -1 Query: 149 ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKA 3 + VP S++G LDS G D+ F + E+F AHKL+LAARSP FK+ Sbjct: 177 VHVPDSELGSHFGVLLDSMEGSDITFNIAGEKFLAHKLVLAARSPFFKS 225 >TAIR9_protein||AT3G03740.1 | Symbols: ATBPM4 | ATBPM4 (BTB-POZ and MATH domain 4); protein binding | chr3:937106-939807 REVERSE Length = 466 Score = 53 bits (125), Expect = 4e-008 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = -1 Query: 149 ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKA 3 I VP SD+G L++ G D+ F V E+F+AH+L+LAARSPVF++ Sbjct: 195 IHVPASDIGSHFGMLLENEDGSDITFNVSGEKFRAHRLVLAARSPVFES 243 >TAIR9_protein||AT3G43700.1 | Symbols: ATBPM6 | ATBPM6 (BTB-POZ and MATH domain 6); protein binding | chr3:15601944-15603499 FORWARD Length = 416 Score = 49 bits (116), Expect = 4e-007 Identities = 24/49 (48%), Positives = 32/49 (65%) Frame = -1 Query: 149 ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKA 3 I VP S++G LD+ G DV F V E+F+AHKL+LAARS F++ Sbjct: 184 IHVPDSELGSHFGKLLDTLQGSDVTFDVAGEKFQAHKLVLAARSQFFRS 232 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,239,339,544 Number of Sequences: 33410 Number of Extensions: 5239339544 Number of Successful Extensions: 280848791 Number of sequences better than 0.0: 0 |