BLASTX 7.6.2 Query= RU35932 /QuerySize=245 (244 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G49840.1 | Symbols: | ATP binding / ATPase/ n... 91 1e-019 >TAIR9_protein||AT5G49840.1 | Symbols: | ATP binding / ATPase/ nucleoside-triphosphatase/ nucleotide binding / protein binding | chr5:20255243-20259035 FORWARD Length = 609 Score = 91 bits (224), Expect = 1e-019 Identities = 40/65 (61%), Positives = 47/65 (72%) Frame = -3 Query: 206 CSEVXXXXXXXEYENIRADVNCPRCSKQMAVLFSTRPLSITGRETGVYQAVNLCPNCNTA 27 CS +Y++IR+DVNCPRCS QM V+FS RPLS+T RE G+YQAVN C C TA Sbjct: 62 CSGGGGGGGGDDYDHIRSDVNCPRCSAQMHVIFSNRPLSLTAREPGIYQAVNFCSQCKTA 121 Query: 26 FYFRP 12 FYFRP Sbjct: 122 FYFRP 126 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,296,011,532 Number of Sequences: 33410 Number of Extensions: 5296011532 Number of Successful Extensions: 280976632 Number of sequences better than 0.0: 0 |