BLASTX 7.6.2 Query= RU36073 /QuerySize=265 (264 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G07160.1 | Symbols: ATGSL10, gsl10 | ATGSL10 (... 57 2e-009 TAIR9_protein||AT2G36850.1 | Symbols: ATGSL08, GSL8, GSL08, ATGS... 54 2e-008 TAIR9_protein||AT1G06490.1 | Symbols: ATGSL07, gsl07, atgsl7 | A... 52 8e-008 TAIR9_protein||AT1G05570.1 | Symbols: CALS1, GSL06, ATGSL6, ATGS... 50 2e-007 TAIR9_protein||AT2G31960.1 | Symbols: ATGSL03, GSL03, ATGSL3 | A... 50 2e-007 TAIR9_protein||AT5G13000.1 | Symbols: ATGSL12, gsl12 | ATGSL12 (... 50 2e-007 TAIR9_protein||AT5G13000.2 | Symbols: ATGSL12, gsl12 | ATGSL12 (... 50 2e-007 TAIR9_protein||AT2G13680.1 | Symbols: CALS5, GLS2, ATGSL02 | CAL... 49 4e-007 TAIR9_protein||AT5G36870.1 | Symbols: ATGSL09, gsl09, atgsl9 | A... 49 5e-007 TAIR9_protein||AT3G59100.1 | Symbols: ATGSL11, gsl11 | ATGSL11 (... 47 1e-006 >TAIR9_protein||AT3G07160.1 | Symbols: ATGSL10, gsl10 | ATGSL10 (glucan synthase-like 10); 1,3-beta-glucan synthase | chr3:2265142-2279383 REVERSE Length = 1942 Score = 57 bits (135), Expect = 2e-009 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHLLETTP 166 WFPFVSTFQTR+MFNQAFSRGLEIS+ L P Sbjct: 1905 WFPFVSTFQTRMMFNQAFSRGLEISLILAGDNP 1937 >TAIR9_protein||AT2G36850.1 | Symbols: ATGSL08, GSL8, GSL08, ATGSL8 | GSL8 (GLUCAN SYNTHASE-LIKE 8); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups | chr2:15454935-15469666 REVERSE Length = 1910 Score = 54 bits (128), Expect = 2e-008 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHL 181 WFPF+STFQ+RL+FNQAFSRGLEIS+ L Sbjct: 1873 WFPFISTFQSRLLFNQAFSRGLEISIIL 1900 >TAIR9_protein||AT1G06490.1 | Symbols: ATGSL07, gsl07, atgsl7 | ATGSL07 (glucan synthase-like 7); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups | chr1:1978762-1989046 FORWARD Length = 1934 Score = 52 bits (122), Expect = 8e-008 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHL 181 WFPFVS FQTRL+FNQAFSRGL+IS+ L Sbjct: 1894 WFPFVSEFQTRLLFNQAFSRGLQISMIL 1921 >TAIR9_protein||AT1G05570.1 | Symbols: CALS1, GSL06, ATGSL6, ATGSL06, GSL6 | CALS1 (CALLOSE SYNTHASE 1); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups | chr1:1647880-1658677 REVERSE Length = 1951 Score = 50 bits (118), Expect = 2e-007 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEIS 190 WFPFVS FQTR++FNQAFSRGL+IS Sbjct: 1910 WFPFVSEFQTRMLFNQAFSRGLQIS 1934 >TAIR9_protein||AT2G31960.1 | Symbols: ATGSL03, GSL03, ATGSL3 | ATGSL03 (GLUCAN SYNTHASE-LIKE 3); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups | chr2:13589545-13600066 FORWARD Length = 1960 Score = 50 bits (118), Expect = 2e-007 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEIS 190 WFPFVS FQTR++FNQAFSRGL+IS Sbjct: 1919 WFPFVSEFQTRMLFNQAFSRGLQIS 1943 >TAIR9_protein||AT5G13000.1 | Symbols: ATGSL12, gsl12 | ATGSL12 (glucan synthase-like 12); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups | chr5:4110445-4121202 REVERSE Length = 2000 Score = 50 bits (118), Expect = 2e-007 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEIS 190 WFPFVS FQTR++FNQAFSRGL+IS Sbjct: 1959 WFPFVSEFQTRMLFNQAFSRGLQIS 1983 >TAIR9_protein||AT5G13000.2 | Symbols: ATGSL12, gsl12 | ATGSL12 (glucan synthase-like 12); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups | chr5:4110445-4121202 REVERSE Length = 1982 Score = 50 bits (118), Expect = 2e-007 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEIS 190 WFPFVS FQTR++FNQAFSRGL+IS Sbjct: 1941 WFPFVSEFQTRMLFNQAFSRGLQIS 1965 >TAIR9_protein||AT2G13680.1 | Symbols: CALS5, GLS2, ATGSL02 | CALS5 (CALLOSE SYNTHASE 5); 1,3-beta-glucan synthase | chr2:5695124-5706134 FORWARD Length = 1924 Score = 49 bits (116), Expect = 4e-007 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEI 193 WFPFVS FQTRL+FNQAFSRGL+I Sbjct: 1889 WFPFVSEFQTRLLFNQAFSRGLQI 1912 >TAIR9_protein||AT5G36870.1 | Symbols: ATGSL09, gsl09, atgsl9 | ATGSL09 (glucan synthase-like 9); 1,3-beta-glucan synthase | chr5:14518316-14533930 FORWARD Length = 1863 Score = 49 bits (115), Expect = 5e-007 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEIS 190 WFPF+S FQTR++FNQAFSRGL IS Sbjct: 1822 WFPFISEFQTRMLFNQAFSRGLHIS 1846 >TAIR9_protein||AT3G59100.1 | Symbols: ATGSL11, gsl11 | ATGSL11 (glucan synthase-like 11); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups | chr3:21843407-21853860 FORWARD Length = 1935 Score = 47 bits (111), Expect = 1e-006 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHL 181 WFP VS FQ RL+FNQAFSRGL+IS+ L Sbjct: 1895 WFPIVSEFQARLLFNQAFSRGLQISMIL 1922 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,296,011,532 Number of Sequences: 33410 Number of Extensions: 5296011532 Number of Successful Extensions: 280976632 Number of sequences better than 0.0: 0 |