BLASTX 7.6.2 Query= RU36178 /QuerySize=144 (143 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G26170.1 | Symbols: | unknown protein | chr4:... 46 4e-006 >TAIR9_protein||AT4G26170.1 | Symbols: | unknown protein | chr4:13256930-13259382 FORWARD Length = 507 Score = 46 bits (108), Expect = 4e-006 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = -1 Query: 122 PVQLPPVHVCESSTSICGFILADGSPCRTEPIQGRKRCDE 3 P ++P V CE + +ICG IL D CR++P+ RKRC++ Sbjct: 345 PCEVPTVRECEETENICGVILPDMIRCRSKPVSRRKRCED 384 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,324,370,947 Number of Sequences: 33410 Number of Extensions: 5324370947 Number of Successful Extensions: 281023678 Number of sequences better than 0.0: 0 |