BLASTX 7.6.2 Query= RU36459 /QuerySize=273 (272 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G27340.1 | Symbols: | Met-10+ like family pro... 67 2e-012 >TAIR9_protein||AT4G27340.1 | Symbols: | Met-10+ like family protein | chr4:13687366-13690370 REVERSE Length = 620 Score = 67 bits (162), Expect = 2e-012 Identities = 29/45 (64%), Positives = 41/45 (91%) Frame = +2 Query: 26 GKSDGDGEPLSAVLYREKLAKTFDSRGYVNFRNLAKMSRPNQKKR 160 GK++GDGE LS+VL+R+KLA+TF+S GY+ FRNLAK+SRP +K++ Sbjct: 177 GKAEGDGERLSSVLHRDKLARTFNSTGYLKFRNLAKISRPKRKRK 221 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,324,370,947 Number of Sequences: 33410 Number of Extensions: 5324370947 Number of Successful Extensions: 281023678 Number of sequences better than 0.0: 0 |